KMSFGEALEVLKQGMQVYRSGWNGKNMFLFLKSSDALASNEPVFGNIIFIKTADNKIHAWVPSQTDVLAEDWDIVS
The query sequence (length=76) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8smg:B | 76 | 76 | 1.0000 | 1.0000 | 1.0000 | 1.62e-52 | 8smf:C, 8smf:H |
2 | 8smf:E | 84 | 84 | 0.9737 | 0.8810 | 0.8810 | 1.28e-47 | 8smf:D, 8smf:F, 8smf:B, 8smf:A, 8smf:G |
3 | 8kbj:B | 104 | 102 | 0.5132 | 0.3750 | 0.3824 | 1.16e-15 | 8kbj:A, 8kbj:C, 8kbj:D, 8kbk:A, 8kbk:C, 8kbk:D, 8kbk:B, 8kbl:A, 8kbm:A, 8kbm:B, 8wjc:A, 8wjc:D, 8wjc:B, 8wjc:C |
4 | 8wjd:A | 101 | 97 | 0.4079 | 0.3069 | 0.3196 | 8.49e-12 | |
5 | 8ptk:f | 4502 | 32 | 0.1579 | 0.0027 | 0.3750 | 0.30 | 8ptk:e |
6 | 7z8f:e | 4579 | 32 | 0.1579 | 0.0026 | 0.3750 | 0.31 | 5owo:A, 8pr2:f, 8ptk:m, 8ptk:n, 7z8f:f, 7z8f:m, 7z8f:n, 7z8h:A |
7 | 5fw4:A | 368 | 24 | 0.1316 | 0.0272 | 0.4167 | 0.93 | 5fw4:B |
8 | 2e46:A | 157 | 31 | 0.1711 | 0.0828 | 0.4194 | 2.3 | 2e47:A, 2e47:B |
9 | 7lgp:B | 377 | 31 | 0.1316 | 0.0265 | 0.3226 | 3.2 | 7lgp:A |
10 | 5ja2:A | 1238 | 36 | 0.1842 | 0.0113 | 0.3889 | 4.2 | 5ja1:A, 5t3d:A |
11 | 3tlk:A | 296 | 41 | 0.1711 | 0.0439 | 0.3171 | 5.9 | 3tlk:C, 3tlk:B |
12 | 8eg3:A | 554 | 33 | 0.1579 | 0.0217 | 0.3636 | 7.0 | 1p49:A |