BioLiP

>protein
KMRHKRTSTKSFNMVQAFGLRGPGDLQGNFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKLTHQNNDDGNPVYFL
RYSGAIKLDPKNPNYNKWLELLEQNIDAYKTFP

The query sequence (length=113) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6g13:B	113	113	1.0000	1.0000	1.0000	1.11e-82	6g13:A
2	7o36:C	113	113	0.5310	0.5310	0.5310	5.31e-35	7n0i:D, 7o35:C, 7o35:D, 7o36:A, 7o36:B, 7o36:D, 7uxz:AAA, 7xxk:A, 7xxk:B, 7xxk:C, 7xxk:E
3	5vug:A	268	69	0.1858	0.0784	0.3043	1.1
4	2tbv:C	321	45	0.1327	0.0467	0.3333	2.0	2tbv:A, 2tbv:B
5	4s3q:A	682	100	0.1858	0.0308	0.2100	3.2	4s3r:A
6	4pof:A	255	36	0.0973	0.0431	0.3056	4.3	5iy0:A, 5iy0:B, 5iy0:C, 5iy0:D, 5iy0:E, 5iy0:F, 4pof:B, 4pof:C, 4pof:D, 4pof:E, 4pof:F, 4pog:A, 4pog:E, 4pog:F, 4pog:K, 4pog:L, 4pog:G, 4pog:H, 4pog:I, 4pog:J, 4pog:B, 4pog:C, 4pog:D, 4ywl:A, 4ywl:B, 4ywl:C, 4ywl:D, 4ywl:E, 4ywl:F, 4ywl:G, 4ywl:H, 4ywl:I, 4ywl:J, 4ywm:A, 4ywm:B, 4ywm:C, 4ywm:D, 4ywm:E, 4ywm:F, 4ywm:G, 4ywm:H, 4ywm:I, 4ywm:J
7	4wcj:A	233	36	0.0796	0.0386	0.2500	4.7
8	2qcx:B	227	27	0.1062	0.0529	0.4444	5.8	2qcx:A, 1to9:A, 1to9:B, 1yak:A, 1yak:B, 1yak:C, 1yak:D
9	4u7e:B	163	58	0.1504	0.1043	0.2931	6.4	4txq:A, 4txq:B, 4txr:A
10	6mrl:D	326	27	0.0708	0.0245	0.2963	7.4	6mrl:A, 6mrl:B
11	2gks:B	529	16	0.0885	0.0189	0.6250	8.1	2gks:A

[Back]