KMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFN
LLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQ
KRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE
The query sequence (length=220) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1yyk:A | 221 | 220 | 1.0000 | 0.9955 | 1.0000 | 4.19e-158 | 2ez6:A, 2ez6:B, 1jfz:A, 1jfz:B, 1jfz:C, 1jfz:D, 4m2z:A, 4m2z:B, 4m30:A, 4m30:B, 2nue:A, 2nuf:A, 2nuf:B, 2nug:A, 2nug:B, 1rc5:A, 1rc5:B, 1rc5:C, 1rc5:D, 1rc7:A, 1yyo:A, 1yyw:A, 1yyw:C, 1yz9:A |
2 | 7r97:A | 226 | 224 | 0.3455 | 0.3363 | 0.3393 | 1.04e-27 | 7r97:B |
3 | 7v6c:A | 1540 | 252 | 0.3318 | 0.0474 | 0.2897 | 2.30e-19 | |
4 | 7w0b:A | 1586 | 253 | 0.3227 | 0.0448 | 0.2806 | 5.78e-18 | 7w0d:F |
5 | 8hf0:A | 1561 | 259 | 0.3227 | 0.0455 | 0.2741 | 2.86e-17 | 8hf0:D, 8hf1:A, 8hf1:D, 8hf1:G, 7w0a:A, 7w0a:E, 7w0c:A, 7w0d:A, 7w0e:A, 7w0f:A |
6 | 7xw2:A | 725 | 157 | 0.2136 | 0.0648 | 0.2994 | 5.23e-17 | |
7 | 7xw2:A | 725 | 62 | 0.0864 | 0.0262 | 0.3065 | 3.5 | |
8 | 5zal:A | 1314 | 158 | 0.2136 | 0.0358 | 0.2975 | 6.84e-17 | 2eb1:A, 2eb1:B, 2eb1:C, 4ngd:A, 5zam:A |
9 | 5zal:A | 1314 | 134 | 0.1636 | 0.0274 | 0.2687 | 0.045 | 2eb1:A, 2eb1:B, 2eb1:C, 4ngd:A, 5zam:A |
10 | 7yym:A | 1281 | 154 | 0.2091 | 0.0359 | 0.2987 | 8.98e-17 | 4ngb:A, 4ngc:A, 4ngg:A, 4nh3:A, 4nh5:A, 4nh6:A, 7yyn:A, 7zpi:A, 7zpj:A, 7zpk:A |
11 | 7yym:A | 1281 | 73 | 0.0955 | 0.0164 | 0.2877 | 1.4 | 4ngb:A, 4ngc:A, 4ngg:A, 4nh3:A, 4nh5:A, 4nh6:A, 7yyn:A, 7zpi:A, 7zpj:A, 7zpk:A |
12 | 8dg5:A | 1635 | 164 | 0.2091 | 0.0281 | 0.2805 | 8.12e-16 | 8dg7:A |
13 | 8dg5:A | 1635 | 100 | 0.1227 | 0.0165 | 0.2700 | 0.99 | 8dg7:A |
14 | 8dfv:A | 1664 | 164 | 0.2091 | 0.0276 | 0.2805 | 8.95e-16 | |
15 | 8dfv:A | 1664 | 100 | 0.1227 | 0.0162 | 0.2700 | 1.0 | |
16 | 8dga:A | 1629 | 176 | 0.2091 | 0.0282 | 0.2614 | 5.49e-14 | |
17 | 8dga:A | 1629 | 100 | 0.1227 | 0.0166 | 0.2700 | 1.3 | |
18 | 7eld:A | 1137 | 142 | 0.2045 | 0.0396 | 0.3169 | 5.52e-14 | 7ele:A |
19 | 7eld:A | 1137 | 119 | 0.1591 | 0.0308 | 0.2941 | 1.09e-05 | 7ele:A |
20 | 5b16:A | 722 | 170 | 0.2273 | 0.0693 | 0.2941 | 1.01e-12 | |
21 | 5b16:A | 722 | 232 | 0.2636 | 0.0803 | 0.2500 | 3.82e-12 | |
22 | 2a11:A | 154 | 146 | 0.2136 | 0.3052 | 0.3219 | 1.45e-12 | |
23 | 6lxe:A | 768 | 162 | 0.2227 | 0.0638 | 0.3025 | 3.77e-12 | |
24 | 6lxe:A | 768 | 152 | 0.1727 | 0.0495 | 0.2500 | 3.13e-06 | |
25 | 6lxd:A | 918 | 232 | 0.2636 | 0.0632 | 0.2500 | 3.83e-11 | 9asm:A, 9asn:A, 9aso:A, 9asp:A, 9asq:A, 6v5b:A, 6v5c:A |
26 | 6lxd:A | 918 | 114 | 0.1636 | 0.0392 | 0.3158 | 1.70e-07 | 9asm:A, 9asn:A, 9aso:A, 9asp:A, 9asq:A, 6v5b:A, 6v5c:A |
27 | 7vg3:A | 860 | 155 | 0.1955 | 0.0500 | 0.2774 | 1.36e-09 | 7vg2:A |
28 | 7vg3:A | 860 | 83 | 0.1136 | 0.0291 | 0.3012 | 0.10 | 7vg2:A |
29 | 7zpk:C | 233 | 79 | 0.1182 | 0.1116 | 0.3291 | 3.36e-06 | 3adl:A, 5n8l:A, 5n8m:A |
30 | 7zpk:C | 233 | 64 | 0.1000 | 0.0944 | 0.3438 | 9.7 | 3adl:A, 5n8l:A, 5n8m:A |
31 | 1di2:A | 69 | 60 | 0.1045 | 0.3333 | 0.3833 | 7.55e-06 | |
32 | 8dfv:K | 253 | 101 | 0.1455 | 0.1265 | 0.3168 | 6.90e-05 | 8dg5:K |
33 | 8dfv:K | 253 | 65 | 0.1091 | 0.0949 | 0.3692 | 0.001 | 8dg5:K |
34 | 8dga:K | 182 | 65 | 0.1091 | 0.1319 | 0.3692 | 3.26e-04 | 8dg7:K |
35 | 6sdw:A | 177 | 62 | 0.0864 | 0.1073 | 0.3065 | 3.38e-04 | 6htu:A, 6htu:B, 6htu:C, 6sdy:A |
36 | 6sdw:A | 177 | 43 | 0.0864 | 0.1073 | 0.4419 | 0.033 | 6htu:A, 6htu:B, 6htu:C, 6sdy:A |
37 | 3rv0:B | 304 | 212 | 0.2773 | 0.2007 | 0.2877 | 4.68e-04 | 3rv0:A, 3rv0:C, 3rv0:D |
38 | 1ekz:A | 76 | 45 | 0.0773 | 0.2237 | 0.3778 | 5.23e-04 | |
39 | 5t16:A | 276 | 100 | 0.1273 | 0.1014 | 0.2800 | 0.003 | 2lbs:B, 2lup:B, 4oog:C, 5t16:B, 5t16:I, 5t16:J, 1t4l:B |
40 | 2ffl:A | 732 | 117 | 0.1591 | 0.0478 | 0.2991 | 0.018 | 2ffl:B, 2ffl:C, 2ffl:D, 2qvw:A, 2qvw:B, 2qvw:C, 2qvw:D |
41 | 7zlq:B | 82 | 50 | 0.0727 | 0.1951 | 0.3200 | 0.032 | 7zlq:A |
42 | 5ztm:A | 168 | 69 | 0.0909 | 0.1190 | 0.2899 | 0.13 | 5ztm:B |
43 | 7v6c:B | 260 | 84 | 0.0909 | 0.0769 | 0.2381 | 0.13 | |
44 | 7v6c:B | 260 | 62 | 0.0727 | 0.0615 | 0.2581 | 0.34 | |
45 | 2l3j:A | 236 | 47 | 0.0682 | 0.0636 | 0.3191 | 0.15 | 2l3c:A |
46 | 2l3j:A | 236 | 53 | 0.0727 | 0.0678 | 0.3019 | 3.2 | 2l3c:A |
47 | 1di2:B | 60 | 60 | 0.0864 | 0.3167 | 0.3167 | 2.1 | |
48 | 4at5:A | 294 | 50 | 0.0545 | 0.0408 | 0.2400 | 2.4 | 4at3:A, 4at4:A |
49 | 4gd3:A | 179 | 64 | 0.0682 | 0.0838 | 0.2344 | 2.8 | 6g94:A, 6g94:B, 4gd3:B |
50 | 7nkb:G | 251 | 78 | 0.0909 | 0.0797 | 0.2564 | 3.5 | 7nkk:G, 7nkn:G |
51 | 5dv7:C | 137 | 51 | 0.0727 | 0.1168 | 0.3137 | 3.7 | |
52 | 5dv7:C | 137 | 52 | 0.0727 | 0.1168 | 0.3077 | 7.0 | |
53 | 9asp:C | 92 | 64 | 0.0909 | 0.2174 | 0.3125 | 6.1 | |
54 | 5mza:A | 440 | 54 | 0.0773 | 0.0386 | 0.3148 | 6.5 | |
55 | 6ywe:5 | 350 | 56 | 0.0773 | 0.0486 | 0.3036 | 8.0 | 6yws:5, 6ywv:5, 6ywx:5, 6ywy:5 |