KMCMNASCGTTSTVEWKKGWPLRSGLLADLCYRCGSAYESSLFCEQFHKDQSGWRECYLCSKRLHCGCIASKVTIELMDY
GGVGCSTCAC
The query sequence (length=90) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5yug:E | 102 | 90 | 1.0000 | 0.8824 | 1.0000 | 8.25e-63 | 5yug:A, 5yug:B, 5yug:G, 5yuh:A |
2 | 5z28:B | 98 | 90 | 0.6556 | 0.6020 | 0.6556 | 9.70e-38 | 5z28:A |
3 | 3v8x:A | 853 | 51 | 0.1778 | 0.0188 | 0.3137 | 0.100 | |
4 | 8qoy:A | 1036 | 47 | 0.1556 | 0.0135 | 0.2979 | 0.81 | |
5 | 7yet:A | 999 | 29 | 0.1333 | 0.0120 | 0.4138 | 1.2 | |
6 | 7yes:A | 1369 | 29 | 0.1333 | 0.0088 | 0.4138 | 1.3 | 8jsl:A, 8jsm:A, 8jsn:A, 7yer:A |
7 | 7l7b:D | 1148 | 58 | 0.2000 | 0.0157 | 0.3103 | 1.9 | |
8 | 8i23:D | 1154 | 75 | 0.2222 | 0.0173 | 0.2667 | 2.0 | 8i24:D |
9 | 8aaf:e | 1527 | 32 | 0.1444 | 0.0085 | 0.4062 | 3.3 | 8agt:e, 8agu:e, 8agv:e, 8agw:e, 8agx:e, 8agz:e |
10 | 4wxx:B | 1178 | 50 | 0.1667 | 0.0127 | 0.3000 | 5.6 | 3epz:A, 3epz:B, 7lmk:A, 7lmk:B, 7lmk:C, 7lmk:D, 7lmm:A, 7lmm:B, 7lmm:C, 7lmm:D, 3pta:A, 7sfc:A, 7sfd:A, 7sfe:A, 7sff:A, 7sfg:A, 5wvo:C, 4wxx:A, 6x9i:A, 6x9j:A, 6x9k:A, 7xi9:A, 7xib:A, 5ydr:B, 4yoc:A |
11 | 2p4q:A | 476 | 47 | 0.1889 | 0.0357 | 0.3617 | 9.6 |