BioLiP

>protein
KLYKNIEIDTDTHSVYIHKILLNLTLTEYKIISFMIDQPHKVFTRGELMNHCMNSDALERTVDSHVSKLRKKLEEQGIFQ
MLINVRGVGYRLDNP

The query sequence (length=95) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5x5l:E	98	97	0.9895	0.9592	0.9691	3.08e-64	5x5l:B, 5x5l:H, 5x5l:A
2	2z33:A	104	93	0.3368	0.3077	0.3441	2.26e-16	1gxp:A, 1gxp:B, 1gxp:E, 1gxp:F
3	7e1b:A	209	91	0.3684	0.1675	0.3846	3.68e-12	7e1b:B, 7e1b:C, 7e1b:H, 7e1b:D, 7e1b:E, 7e1b:F, 7e1b:G, 7e1h:A, 7e1h:B, 7e1h:E
4	4b09:A	218	76	0.3158	0.1376	0.3947	7.34e-11	4b09:B, 4b09:C, 4b09:D, 4b09:E, 4b09:F, 4b09:G, 4b09:I, 4b09:K
5	2oqr:A	226	91	0.2842	0.1195	0.2967	2.59e-10
6	2gwr:A	225	92	0.3158	0.1333	0.3261	8.04e-10	3nhz:B, 3nhz:C, 3nhz:D
7	8hig:A	98	91	0.2947	0.2857	0.3077	8.72e-10	8hig:B, 8hml:A, 8hml:B
8	8hih:O	217	91	0.3263	0.1429	0.3407	5.35e-09	8hih:P, 8hih:N, 8hih:Q
9	5ed4:E	224	95	0.2947	0.1250	0.2947	1.76e-08	5ed4:A, 5ed4:B, 5ed4:F, 2pmu:E
10	6lxn:A	110	91	0.2421	0.2091	0.2527	1.03e-06	6lxn:B
11	1ys6:B	227	89	0.2632	0.1101	0.2809	2.36e-06	1ys6:A, 1ys7:A, 1ys7:B
12	7lza:A	219	93	0.2842	0.1233	0.2903	7.06e-06	7lz9:A
13	6cqg:A	98	93	0.2842	0.2755	0.2903	2.05e-04
14	4nhj:A	102	91	0.2211	0.2059	0.2308	0.26	4nhj:B
15	8tlq:A	1283	89	0.2737	0.0203	0.2921	0.37	8tlt:A, 6v93:A
16	5afq:B	444	64	0.1579	0.0338	0.2344	0.91
17	7x7q:A	185	30	0.1053	0.0541	0.3333	5.4	7x5a:A, 7x5a:C, 7x5a:F, 7x5a:B, 7x5a:G, 7x5a:D, 7x7q:C, 7x7q:F, 7x7q:D, 7x7q:E, 7x7q:H, 7x7q:B
18	6yc8:A	240	48	0.1684	0.0667	0.3333	6.3
19	8ffu:A	360	59	0.2000	0.0528	0.3220	7.7	8fft:A, 8fft:B, 8fft:C, 8fft:D, 8ffu:B, 8ffu:C, 8ffu:D

[Back]