KLTLWTTLDPSPNCRIDVDKDSKLTLVLTKCGSQILANVSLLVVKGRFQNLNYKTNPNLPKTFTIKLLFDENGILKDSSN
LDKNYWNYRNGNNAVGFMPNLAAYPKSTTTQSKLYARNTIFGNIYLDSQAYNPVVIKITFNQEADSAYSITLNYSWGKDY
ENIPFDSTSFTFSYIAQE
The query sequence (length=178) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8ofr:B | 186 | 186 | 1.0000 | 0.9570 | 0.9570 | 3.88e-127 | 8ofr:A, 8ofr:C, 8ofr:D, 8ofr:E, 8ofr:F, 8ofr:G, 8ofr:H, 8ofr:I, 8ofr:J, 8ofr:K, 8ofr:L, 8ofr:M, 8ofr:N, 8ofr:O, 8ofr:P, 8ofr:Q, 8ofr:R, 8ofr:S, 8ofr:T, 8ofr:U, 8ofr:V, 8ofr:W, 8ofr:X |
2 | 6stt:A | 178 | 178 | 0.7753 | 0.7753 | 0.7753 | 1.64e-100 | 6stt:B |
3 | 8ofv:F | 175 | 178 | 0.6854 | 0.6971 | 0.6854 | 3.09e-82 | 8ofv:L |
4 | 4k6u:B | 187 | 184 | 0.6517 | 0.6203 | 0.6304 | 2.07e-76 | 4k6t:A, 4k6t:B, 4k6t:C, 4k6t:E, 4k6t:F, 4k6t:G, 4k6u:A, 4k6u:C, 4k6v:A, 4k6v:B, 4k6v:C, 4k6w:A, 4k6w:B, 4k6w:C, 3n0i:A, 3n0i:B, 3qnd:A, 3qnd:B, 3qnd:C, 3qnd:E, 3qnd:F, 3qnd:G, 1uxa:A, 1uxa:B, 1uxa:C, 1uxb:A, 1uxb:B, 1uxb:C, 1uxe:A, 1uxe:B, 2wbw:A, 2wgt:A, 2wgt:B, 2wgt:C, 2wgu:A, 2wgu:B, 2wgu:C, 4xqa:A, 4xqa:B, 4xqa:C, 4xqb:A, 4xqb:B, 4xqb:C |
5 | 6stu:A | 204 | 195 | 0.6124 | 0.5343 | 0.5590 | 2.42e-67 | 8ofs:A, 8ofs:B, 8ofs:C |
6 | 6qu6:A | 189 | 188 | 0.5730 | 0.5397 | 0.5426 | 4.60e-64 | 6fjo:A, 6qu8:A |
7 | 7op2:A | 187 | 196 | 0.5056 | 0.4813 | 0.4592 | 6.02e-47 | 7op2:D, 7op2:G |
8 | 6g47:A | 171 | 184 | 0.3202 | 0.3333 | 0.3098 | 1.96e-19 | 6g47:C, 4xl8:A, 4xl8:B, 4xl8:C |
9 | 2wbv:B | 186 | 189 | 0.2303 | 0.2204 | 0.2169 | 1.4 | 2w9l:C, 2w9l:D, 2w9l:E, 2w9l:F, 2w9l:H, 2w9l:I, 2w9l:L, 2w9l:M, 2w9l:N, 2w9l:Q, 2w9l:R, 2w9l:S, 2wbv:D, 2wbv:A, 2wbv:C, 2wbv:E, 2wbv:F |
10 | 6dii:H | 616 | 51 | 0.1124 | 0.0325 | 0.3922 | 2.7 | 6dii:A, 6dii:B, 6dii:C, 6dii:D, 6dii:E, 6dii:F, 6dii:G, 6dii:I, 6dii:J, 6dii:K, 6dii:L, 8ey1:D, 8ey1:F, 8ey1:H, 8ey1:J, 8ey1:L, 8ey9:B, 8ey9:E, 8ey9:F, 8ey9:G, 8ey9:H, 8ey9:I |
11 | 8sod:A | 941 | 70 | 0.1124 | 0.0213 | 0.2857 | 3.0 | 8soe:A |
12 | 4qiw:B | 1069 | 69 | 0.1067 | 0.0178 | 0.2754 | 9.1 | 4qiw:J |
13 | 6kf3:B | 1114 | 69 | 0.1067 | 0.0171 | 0.2754 | 9.1 | 9bct:B, 9bcu:B, 6kf4:B, 6kf9:B |