KLTLWTTLDPSPNCRIDVDKDSKLTLVLTKCGSQILANVSLLVVKGRFQNLNYKTNPNLPKTFTIKLLFDENGILKDSSN
LDKNYWNYRLAEQYKNAVGFMPNLAAYPKSTTTQSKLYARNTIFGNIYLDSQAYNPVVIKITFNQEADSAYSITLNYSWG
KDYENIPFDSTSFTFSYIAQE
The query sequence (length=181) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8ofr:B | 186 | 186 | 1.0000 | 0.9731 | 0.9731 | 4.32e-130 | 8ofr:A, 8ofr:C, 8ofr:D, 8ofr:E, 8ofr:F, 8ofr:G, 8ofr:H, 8ofr:I, 8ofr:J, 8ofr:K, 8ofr:L, 8ofr:M, 8ofr:N, 8ofr:O, 8ofr:P, 8ofr:Q, 8ofr:R, 8ofr:S, 8ofr:T, 8ofr:U, 8ofr:V, 8ofr:W, 8ofr:X |
2 | 6stt:A | 178 | 180 | 0.7624 | 0.7753 | 0.7667 | 3.86e-100 | 6stt:B |
3 | 8ofv:F | 175 | 181 | 0.6685 | 0.6914 | 0.6685 | 5.54e-81 | 8ofv:L |
4 | 4k6u:B | 187 | 184 | 0.6354 | 0.6150 | 0.6250 | 2.45e-76 | 4k6t:A, 4k6t:B, 4k6t:C, 4k6t:E, 4k6t:F, 4k6t:G, 4k6u:A, 4k6u:C, 4k6v:A, 4k6v:B, 4k6v:C, 4k6w:A, 4k6w:B, 4k6w:C, 3n0i:A, 3n0i:B, 3qnd:A, 3qnd:B, 3qnd:C, 3qnd:E, 3qnd:F, 3qnd:G, 1uxa:A, 1uxa:B, 1uxa:C, 1uxb:A, 1uxb:B, 1uxb:C, 1uxe:A, 1uxe:B, 2wbw:A, 2wgt:A, 2wgt:B, 2wgt:C, 2wgu:A, 2wgu:B, 2wgu:C, 4xqa:A, 4xqa:B, 4xqa:C, 4xqb:A, 4xqb:B, 4xqb:C |
5 | 6stu:A | 204 | 195 | 0.6022 | 0.5343 | 0.5590 | 1.18e-68 | 8ofs:A, 8ofs:B, 8ofs:C |
6 | 6qu6:A | 189 | 188 | 0.5635 | 0.5397 | 0.5426 | 2.26e-65 | 6fjo:A, 6qu8:A |
7 | 7op2:A | 187 | 196 | 0.4972 | 0.4813 | 0.4592 | 1.90e-47 | 7op2:D, 7op2:G |
8 | 6g47:A | 171 | 184 | 0.3094 | 0.3275 | 0.3043 | 1.83e-18 | 6g47:C, 4xl8:A, 4xl8:B, 4xl8:C |
9 | 6dii:H | 616 | 51 | 0.1105 | 0.0325 | 0.3922 | 2.6 | 6dii:A, 6dii:B, 6dii:C, 6dii:D, 6dii:E, 6dii:F, 6dii:G, 6dii:I, 6dii:J, 6dii:K, 6dii:L, 8ey1:D, 8ey1:F, 8ey1:H, 8ey1:J, 8ey1:L, 8ey9:B, 8ey9:E, 8ey9:F, 8ey9:G, 8ey9:H, 8ey9:I |
10 | 8sod:A | 941 | 70 | 0.1105 | 0.0213 | 0.2857 | 3.7 | 8soe:A |
11 | 4qiw:B | 1069 | 69 | 0.1050 | 0.0178 | 0.2754 | 9.4 | 4qiw:J |
12 | 6kf3:B | 1114 | 69 | 0.1050 | 0.0171 | 0.2754 | 9.4 | 9bct:B, 9bcu:B, 6kf4:B, 6kf9:B |
13 | 4n4r:C | 533 | 84 | 0.1215 | 0.0413 | 0.2619 | 9.9 | 4n4r:A |