BioLiP

>protein
KLTEGQYVLCRWTDGLYYLGKIKRVSSSKQSCLVTFEDNSKYWVLWKDIQHAGVP

The query sequence (length=55) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4bd3:A	58	55	1.0000	0.9483	1.0000	1.43e-36	6wau:A, 6wau:F, 6wau:B, 6wau:D, 6wau:C, 6wau:E
2	2m0o:A	79	54	0.6000	0.4177	0.6111	1.76e-19
3	5xfr:A	309	54	0.6000	0.1068	0.6111	6.74e-18	5xfr:B
4	5xfo:A	315	55	0.6182	0.1079	0.6182	7.82e-18	8h43:A, 8h43:B, 8h43:C, 4hcz:A, 4hcz:B, 7lky:B, 7lky:H, 7lky:A, 7lky:C, 7lky:D, 7lky:E, 7lky:F, 7lky:G, 6wat:AA, 6wat:AC, 6wat:BA, 6wat:BC, 6wat:CA, 6wat:CC, 6wat:DA, 6wat:DC, 6wat:EC, 6wat:EA, 6wat:FA, 6wat:FC, 6wat:GA, 6wat:GC, 6wat:HA, 6wat:HC, 6wat:IA, 6wat:IC, 6wat:JA, 6wat:JC, 6wat:KA, 6wat:KC, 6wat:OC, 6wat:LA, 6wat:LC, 6wat:MA, 6wat:MC, 6wat:NA, 6wat:NC, 6wat:OA, 6wav:A, 6wav:C, 6wav:B, 6wav:D, 5xfn:A, 5xfp:B, 5xfp:A, 5xfp:E, 5xfq:A, 5xfq:B
5	2gfa:B	110	47	0.3455	0.1727	0.4043	0.021	5d6y:A, 5d6y:D, 5d6y:B, 5d6y:C, 2gfa:A, 2qqs:A, 2qqs:B, 5var:A
6	4qg5:A	565	35	0.2364	0.0230	0.3714	0.34	4qg5:B, 4qg5:C, 4qg5:D
7	7bgd:b	163	29	0.2000	0.0675	0.3793	0.71
8	4qro:A	332	30	0.1636	0.0271	0.3000	1.1	4qro:B, 4qro:C, 4qro:D, 4qro:E, 4qro:F, 4qro:G, 4qro:H
9	5x51:M	1386	41	0.2364	0.0094	0.3171	4.5	5x4z:A, 5x51:A, 8yfr:A
10	5mpf:B	202	46	0.2364	0.0644	0.2826	8.3	5mpf:A

[Back]