KLRKMLDDLLVSVDHSGNIAVLRTPPGGAPFLASFIDRVGMEEVVGTIAGDDTVFVLARDPMTGQELGEFLSQR
The query sequence (length=74) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6wjp:A | 80 | 74 | 0.9865 | 0.9125 | 0.9865 | 5.70e-48 | 5jvo:A, 5jvo:B, 6wjo:A, 6wjo:B, 6wjp:B |
2 | 3fhz:D | 166 | 67 | 0.5541 | 0.2470 | 0.6119 | 1.36e-24 | 3cag:A, 3cag:C, 3cag:E, 3cag:B, 3cag:D, 3cag:F, 3ere:D, 3fhz:C, 3fhz:E, 3fhz:B, 3fhz:F, 3fhz:A, 3laj:C, 3laj:E, 3laj:B, 3laj:F, 3laj:A, 3laj:D, 3lap:C, 3lap:E, 3lap:B, 3lap:F, 3lap:A, 3lap:D, 2zfz:A, 2zfz:C, 2zfz:F, 2zfz:B, 2zfz:D, 2zfz:E |
3 | 1b4b:A | 71 | 64 | 0.3243 | 0.3380 | 0.3750 | 1.28e-12 | 1b4b:C, 1b4b:B |
4 | 2p5m:A | 82 | 61 | 0.3108 | 0.2805 | 0.3770 | 2.91e-12 | 2p5m:B, 2p5m:C |
5 | 1xxa:C | 73 | 65 | 0.3243 | 0.3288 | 0.3692 | 1.63e-09 | 1xxa:A, 1xxa:B, 1xxa:D, 1xxa:F, 1xxa:E, 1xxb:A, 1xxb:C, 1xxb:B, 1xxb:D, 1xxb:E, 1xxb:F |
6 | 5eer:A | 247 | 60 | 0.2568 | 0.0769 | 0.3167 | 0.87 | 5ees:A |
7 | 7mqa:NA | 295 | 51 | 0.1892 | 0.0475 | 0.2745 | 1.4 | 7mq8:NA, 7mq9:NA |
8 | 3lot:D | 313 | 40 | 0.1892 | 0.0447 | 0.3500 | 1.9 | 3lot:A, 3lot:B, 3lot:C |
9 | 8bpo:t2 | 418 | 27 | 0.1486 | 0.0263 | 0.4074 | 2.2 | |
10 | 6gsj:AA | 65 | 28 | 0.1622 | 0.1846 | 0.4286 | 2.5 | 5e7k:AA, 5e81:AA, 5el4:AA, 5el6:AA, 5el7:AA, 6gsk:AA, 6gsl:AA, 5ib7:AA, 5ib8:AA, 5ibb:AA |
11 | 6c4m:C | 418 | 21 | 0.1486 | 0.0263 | 0.5238 | 3.4 | |
12 | 4to8:A | 279 | 33 | 0.1892 | 0.0502 | 0.4242 | 4.4 | 4to8:B |
13 | 6yw5:SS | 81 | 57 | 0.2568 | 0.2346 | 0.3333 | 4.7 | 6ywe:SS, 6ywx:SS, 6ywy:SS |
14 | 6joo:A | 834 | 35 | 0.1757 | 0.0156 | 0.3714 | 5.7 | |
15 | 8hmc:B | 1195 | 23 | 0.1216 | 0.0075 | 0.3913 | 6.3 | 8hmd:B |
16 | 3uoz:A | 540 | 48 | 0.1892 | 0.0259 | 0.2917 | 6.8 | 3uov:A, 3uov:B, 3uox:A, 3uox:B, 3uoy:A, 3uoy:B, 3uoz:B, 3up4:A, 3up4:B, 3up5:A, 3up5:B |
17 | 3a22:A | 614 | 40 | 0.1892 | 0.0228 | 0.3500 | 7.1 | 3a22:B, 3a23:A, 3a23:B |
18 | 7unr:s | 83 | 25 | 0.1486 | 0.1325 | 0.4400 | 7.2 | 8cd1:s, 6spc:s, 6spe:s, 6spf:s, 6spg:s, 7unu:s, 7unv:s, 7unw:s |
19 | 3a9i:A | 347 | 29 | 0.1486 | 0.0317 | 0.3793 | 7.7 | 2ztj:A, 2ztk:A, 2zyf:A |
20 | 2rc5:A | 306 | 25 | 0.1622 | 0.0392 | 0.4800 | 8.3 | 2rc5:B, 2rc5:C, 2rc5:D, 2rc6:A, 2rc6:B, 2rc6:C, 2rc6:D |
21 | 2c44:C | 468 | 25 | 0.1486 | 0.0235 | 0.4400 | 9.9 | 2c44:A, 2c44:D, 2c44:B, 5d8g:A |