KLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTILKVSNKGLNSYKDPDNPGRIA
The query sequence (length=79) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7y43:A | 79 | 79 | 1.0000 | 1.0000 | 1.0000 | 7.06e-54 | 8h7a:A, 8h7a:B, 8h7a:E, 8h7a:F |
2 | 6lui:A | 71 | 68 | 0.3291 | 0.3662 | 0.3824 | 5.90e-12 | |
3 | 4j0h:A | 470 | 28 | 0.1519 | 0.0255 | 0.4286 | 0.13 | 4j0h:B, 4j0j:A, 4j0j:B, 4j0k:A, 4j0k:B, 4jui:A, 4jui:B, 3wa7:A |
4 | 1iq8:A | 577 | 71 | 0.2532 | 0.0347 | 0.2817 | 0.86 | 1iq8:B, 1it7:A, 1it7:B, 1it8:A, 1it8:B, 1j2b:A, 1j2b:B |
5 | 6zu5:ST0 | 139 | 51 | 0.2532 | 0.1439 | 0.3922 | 2.6 | |
6 | 7bbr:A | 310 | 43 | 0.1646 | 0.0419 | 0.3023 | 4.0 | 7bcn:A, 7bco:A, 7bco:B, 7bcp:A, 7bcr:A |
7 | 4dyn:A | 437 | 47 | 0.1519 | 0.0275 | 0.2553 | 5.5 | 5b7b:A, 5b7b:C, 5b7b:D, 4bbl:D, 4bbl:F, 4bbl:H, 4bbl:J, 4bbl:L, 4bbl:N, 4bbl:P, 4bbl:R, 4bbl:T, 4bbl:V, 4bbl:X, 4bbl:A, 4bbl:C, 4bbl:E, 4bbl:G, 4bbl:I, 4bbl:K, 4bbl:M, 4bbl:O, 4bbl:Q, 4bbl:S, 4bbl:U, 4dya:A, 4dya:B, 4dyb:A, 4dyb:B, 4dyn:B, 4dyp:A, 4dyp:B, 6h9g:A, 6h9g:C, 6i54:A, 6i54:C, 6i7b:A, 6i7b:C, 6i7m:A, 6i7m:C, 3ro5:A, 3ro5:B, 3tg6:A, 3tg6:B |