BioLiP

>protein
KKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKYLRSVGDGETVEFDVVEGEKGAEAANVTGPG

The query sequence (length=73) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6a6j:A	90	77	0.9863	0.8000	0.9351	3.59e-45	6a6j:C, 6a6l:A, 6ktc:A, 6kug:A, 6lmr:A, 5yts:A, 5ytt:A, 5ytv:A, 5ytx:A
2	7f3i:A	93	78	0.9452	0.7419	0.8846	1.77e-43	7f3i:C, 7f3i:E, 7f3j:A, 7f3j:C, 7f3j:E, 7f3j:G, 7f3k:A, 7f3l:A
3	5udz:A	139	72	0.4384	0.2302	0.4444	1.00e-13	8ops:B, 8opt:B, 8ost:B, 3trz:A, 3trz:B, 3trz:C, 3trz:D, 3trz:E, 3trz:F, 3ts0:A, 3ts0:B, 3ts2:A, 3ts2:B, 5udz:B
4	2es2:A	67	62	0.3973	0.4328	0.4677	5.15e-13	3pf4:B, 3pf5:B, 3pf5:A
5	4a75:A	89	72	0.4384	0.3596	0.4444	5.36e-13	4a75:C, 4a75:E, 4a75:G, 4a76:A, 4a76:G, 4a76:C, 4a76:E, 4alp:A, 4alp:D
6	7ot5:B	66	64	0.3836	0.4242	0.4375	1.16e-11
7	1c9o:A	66	61	0.3973	0.4394	0.4754	1.29e-11	1c9o:B, 2hax:A, 2hax:B
8	7oii:B	39	32	0.2329	0.4359	0.5312	1.63e-06
9	7zhh:A	219	57	0.2055	0.0685	0.2632	1.6
10	4qqb:X	72	54	0.1781	0.1806	0.2407	2.9	4qqb:Y
11	7cfw:A	123	35	0.1918	0.1138	0.4000	3.0	7c1j:A
12	3ts5:E	146	47	0.1918	0.0959	0.2979	3.1	2os8:B, 2otg:B, 3pn7:B, 3pn7:E, 3ts5:B, 3tuy:B, 3tuy:E
13	8fqc:A	168	20	0.1233	0.0536	0.4500	8.5
14	1kij:A	384	34	0.1096	0.0208	0.2353	8.8	6enh:A, 1kij:B

[Back]