KKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPYLRSVGDGETVEFDVVEGEKGAEAANVTGPG
The query sequence (length=76) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6a6j:A | 90 | 77 | 0.9868 | 0.8333 | 0.9740 | 3.17e-48 | 6a6j:C, 6a6l:A, 6ktc:A, 6kug:A, 6lmr:A, 5yts:A, 5ytt:A, 5ytv:A, 5ytx:A |
2 | 7f3i:A | 93 | 78 | 0.9342 | 0.7634 | 0.9103 | 5.07e-46 | 7f3i:C, 7f3i:E, 7f3j:A, 7f3j:C, 7f3j:E, 7f3j:G, 7f3k:A, 7f3l:A |
3 | 5udz:A | 139 | 74 | 0.4211 | 0.2302 | 0.4324 | 9.64e-14 | 8ops:B, 8opt:B, 8ost:B, 3trz:A, 3trz:B, 3trz:C, 3trz:D, 3trz:E, 3trz:F, 3ts0:A, 3ts0:B, 3ts2:A, 3ts2:B, 5udz:B |
4 | 4a75:A | 89 | 74 | 0.4211 | 0.3596 | 0.4324 | 8.32e-13 | 4a75:C, 4a75:E, 4a75:G, 4a76:A, 4a76:G, 4a76:C, 4a76:E, 4alp:A, 4alp:D |
5 | 2es2:A | 67 | 64 | 0.3816 | 0.4328 | 0.4531 | 9.53e-13 | 3pf4:B, 3pf5:B, 3pf5:A |
6 | 7ot5:B | 66 | 66 | 0.3947 | 0.4545 | 0.4545 | 4.30e-12 | |
7 | 1c9o:A | 66 | 64 | 0.3816 | 0.4394 | 0.4531 | 2.67e-11 | 1c9o:B, 2hax:A, 2hax:B |
8 | 7oii:B | 39 | 34 | 0.2237 | 0.4359 | 0.5000 | 1.49e-06 | |
9 | 6ybu:E | 168 | 46 | 0.1974 | 0.0893 | 0.3261 | 1.6 | 6ybu:F, 6ybu:K, 6ybu:L |
10 | 6oiu:C | 900 | 53 | 0.2632 | 0.0222 | 0.3774 | 2.5 | 6oiu:A, 6oiu:B, 6oiu:D |
11 | 4xcq:A | 303 | 70 | 0.2105 | 0.0528 | 0.2286 | 3.1 | |
12 | 7zhh:A | 219 | 60 | 0.2237 | 0.0776 | 0.2833 | 3.9 | |
13 | 7d4c:A | 595 | 28 | 0.1842 | 0.0235 | 0.5000 | 4.1 | 7c3h:A, 7c3h:B, 7c3i:A, 7c3i:B, 7c3j:A, 7c3j:B, 7c3l:A, 7c3l:B, 7d4d:A, 7d4e:A, 3x0v:A, 3x0v:B |
14 | 5azi:A | 513 | 38 | 0.1842 | 0.0273 | 0.3684 | 4.9 | 5azi:B, 5azi:C, 5azi:D, 5azj:A, 5azj:B, 5azj:C, 5azj:D, 5gn5:A, 5gn5:B, 5gn5:C, 5gn5:D, 5gn6:A, 5gn6:B, 5gn6:C, 5gn6:D, 6j9q:A, 6j9q:B, 6j9q:C, 6j9q:D, 6j9v:A, 6j9v:B, 6jaf:A, 3wxj:A, 3wxj:B, 3wxj:C, 3wxj:D, 3wxk:A, 3wxk:B, 3wxk:C, 3wxk:D, 3wxl:A, 3wxl:B, 3wxl:C, 3wxl:D |
15 | 8fqc:A | 168 | 30 | 0.1316 | 0.0595 | 0.3333 | 7.8 |