KKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKKYLRSVGDGETVEFDVVEGEKGAEAANVTGPG
The query sequence (length=74) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6a6j:A | 90 | 77 | 0.9865 | 0.8111 | 0.9481 | 6.33e-46 | 6a6j:C, 6a6l:A, 6ktc:A, 6kug:A, 6lmr:A, 5yts:A, 5ytt:A, 5ytv:A, 5ytx:A |
2 | 7f3i:A | 93 | 78 | 0.9324 | 0.7419 | 0.8846 | 6.17e-44 | 7f3i:C, 7f3i:E, 7f3j:A, 7f3j:C, 7f3j:E, 7f3j:G, 7f3k:A, 7f3l:A |
3 | 5udz:A | 139 | 72 | 0.4324 | 0.2302 | 0.4444 | 2.31e-15 | 8ops:B, 8opt:B, 8ost:B, 3trz:A, 3trz:B, 3trz:C, 3trz:D, 3trz:E, 3trz:F, 3ts0:A, 3ts0:B, 3ts2:A, 3ts2:B, 5udz:B |
4 | 4a75:A | 89 | 72 | 0.4324 | 0.3596 | 0.4444 | 1.49e-14 | 4a75:C, 4a75:E, 4a75:G, 4a76:A, 4a76:G, 4a76:C, 4a76:E, 4alp:A, 4alp:D |
5 | 2es2:A | 67 | 62 | 0.3919 | 0.4328 | 0.4677 | 1.58e-14 | 3pf4:B, 3pf5:B, 3pf5:A |
6 | 7ot5:B | 66 | 64 | 0.3784 | 0.4242 | 0.4375 | 2.80e-13 | |
7 | 1c9o:A | 66 | 61 | 0.3919 | 0.4394 | 0.4754 | 3.64e-13 | 1c9o:B, 2hax:A, 2hax:B |
8 | 7oii:B | 39 | 38 | 0.2432 | 0.4615 | 0.4737 | 5.31e-07 | |
9 | 7s7g:A | 571 | 33 | 0.1892 | 0.0245 | 0.4242 | 4.9 | 3b96:A, 2uxw:A |
10 | 5lj3:C | 882 | 59 | 0.2432 | 0.0204 | 0.3051 | 7.5 | 6exn:C, 5gam:C, 5gan:C, 5lj5:C, 5lqw:B, 5mps:C, 5mq0:C, 5nrl:C |
11 | 8fqc:A | 168 | 20 | 0.1216 | 0.0536 | 0.4500 | 8.1 |