BioLiP

>protein
KKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTFATRKLQPMITSETGKALIQT
CLNS

The query sequence (length=84) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1hbx:E	89	84	1.0000	0.9438	1.0000	7.49e-57	1hbx:A, 1hbx:B, 1hbx:D, 1k6o:B, 1k6o:C, 1srs:A, 1srs:B
2	1mnm:A	85	79	0.6310	0.6235	0.6709	1.24e-34	1mnm:B
3	8c84:B	93	65	0.2738	0.2473	0.3538	1.71e-10	6byy:D, 6bz1:D, 1c7u:A, 1c7u:B, 8c84:A, 1egw:A, 1egw:B, 1egw:C, 1egw:D, 3kov:B, 3kov:A, 3kov:I, 3kov:J, 3mu6:A, 3mu6:B, 3mu6:D, 3mu6:C, 3p57:A, 3p57:B, 3p57:C, 3p57:D, 3p57:I, 3p57:J, 8pde:D, 8pde:E, 8pde:A, 8pde:B, 8q9n:A, 8q9n:B, 8q9p:B, 8q9p:A, 8q9q:A, 8q9q:B, 8q9r:A, 8q9r:B, 8q9r:E, 8q9r:F, 6wc2:C, 7x1n:A, 7x1n:D, 7x1n:B, 7x1n:C, 7xuz:D, 7xuz:C, 7xuz:H, 7xuz:G
4	1n6j:A	93	58	0.2738	0.2473	0.3966	1.58e-09	6byy:A, 6byy:B, 6byy:C, 6bz1:C, 6bz1:A, 6bz1:B, 1n6j:B, 1tqe:P, 1tqe:Q, 1tqe:R, 1tqe:S, 6wc2:I, 6wc2:J, 6wc2:D, 6wc2:A, 6wc2:B, 6wc5:A, 6wc5:B, 6wc5:C, 6wc5:D
5	8jcu:3	765	50	0.2262	0.0248	0.3800	0.59	6b7h:A, 5cnk:A, 5cnm:A, 8jcv:3, 8jcw:3, 8jcx:3, 8jcy:3, 8jcz:3, 8jd0:3, 8jd1:3, 8jd2:3, 8jd3:3, 3sm9:A, 8tr0:A, 7wih:A, 7wih:B, 4xar:A
6	8tr2:A	745	50	0.2381	0.0268	0.4000	0.67	2e4u:A, 2e4u:B, 2e4v:A, 2e4v:B, 2e4w:A, 2e4w:B, 2e4x:A, 2e4x:B, 2e4y:A, 2e4y:B, 8tqb:A, 8tqb:B, 8tr0:B, 8tr2:B, 8trc:A, 8trc:B, 8trd:A, 8trd:B, 7wi6:A, 7wi6:B, 7wi8:A, 7wi8:B
7	7epe:A	389	49	0.1905	0.0411	0.3265	3.0	7epf:A
8	5mrc:8	199	43	0.1786	0.0754	0.3488	3.6	3j6b:8, 5mre:8, 5mrf:8
9	7v4x:A	529	38	0.1429	0.0227	0.3158	5.6	6a37:A, 7v50:A, 7v51:A

[Back]