KKTFREWQYFKLSITSFDQDVDDAHAIDQMTWRQWLNNALKRSYGIFGEGVEYSFLHVDDKLAYIRVNHADKDTFSSSIS
TYISTDELVGSPLTVSILQESSSLRLLEVTDDDRLWLKKVMEEEEQDCKCI
The query sequence (length=131) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6agb:H | 131 | 131 | 1.0000 | 1.0000 | 1.0000 | 3.55e-95 | 6ah3:H |
2 | 5gm4:A | 219 | 81 | 0.1603 | 0.0959 | 0.2593 | 0.20 | 5gm4:B, 5gm4:C, 5gm4:D, 5gm4:E, 5gm4:F, 5gm4:G, 5gm5:A, 5gm5:D, 5gm5:F, 5gm5:G |
3 | 6pop:A | 475 | 25 | 0.1069 | 0.0295 | 0.5600 | 2.9 | 6pop:B, 6pop:C, 6pop:D, 6pop:E, 6pop:F |
4 | 6wcd:A | 314 | 99 | 0.1832 | 0.0764 | 0.2424 | 2.9 | |
5 | 3fp0:A | 511 | 28 | 0.0763 | 0.0196 | 0.3571 | 3.3 | |
6 | 4r7x:A | 150 | 102 | 0.1985 | 0.1733 | 0.2549 | 3.6 | 4r7x:B |
7 | 1j0h:A | 588 | 35 | 0.1069 | 0.0238 | 0.4000 | 4.0 | 1j0h:B, 1j0i:A, 1j0i:B, 1j0j:B, 1j0j:A, 1j0k:A, 1j0k:B |
8 | 6h4h:A | 458 | 44 | 0.0916 | 0.0262 | 0.2727 | 5.7 | 6h4h:B, 8p1p:A |
9 | 7k7m:B | 757 | 70 | 0.1679 | 0.0291 | 0.3143 | 6.5 | 7k7m:A, 7n6b:A |
10 | 6aji:A | 873 | 70 | 0.1679 | 0.0252 | 0.3143 | 6.6 | |
11 | 6ajf:A | 901 | 70 | 0.1679 | 0.0244 | 0.3143 | 6.6 | 6ajg:A, 6ajh:A, 6ajj:A, 7c2m:A, 7c2n:A, 6or2:A, 7wnx:A |
12 | 4qro:A | 332 | 29 | 0.0916 | 0.0361 | 0.4138 | 6.9 | 4qro:B, 4qro:C, 4qro:D, 4qro:E, 4qro:F, 4qro:G, 4qro:H |
13 | 3c25:A | 354 | 80 | 0.1679 | 0.0621 | 0.2750 | 8.1 | 3bvq:A, 3bvq:B, 3c25:B |