KKSVLAPVLDNNPIALQVLGVCSALAVTTKLETAFVMTLAVMFVTALSNFFVSLIRNHIPNSVRIIVQMAIIASLVIVVD
QILKAYLYDISKQLSVFVGLIITNCIVMGRAEAFAMKSEPIPSFIDGIGNGLGYGFVLMTVGFFRELLGSGKLFGLEVLP
LISNGGWYQPNGLMLLAPSAFFLIGFMIWAIRTFKPEQVEAK
The query sequence (length=202) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7xk7:D | 206 | 202 | 1.0000 | 0.9806 | 1.0000 | 6.19e-146 | 8a1t:D, 8a1u:D, 8a1v:D, 8a1w:D, 8a1x:D, 8a1y:D, 8acw:D, 8acy:D, 8ad0:D, 8evu:D, 8ew3:D, 7xk3:D, 7xk4:D, 7xk5:D, 7xk6:D |
2 | 7zc6:E | 194 | 188 | 0.3762 | 0.3918 | 0.4043 | 4.16e-42 | |
3 | 8ahx:E | 213 | 195 | 0.3564 | 0.3380 | 0.3692 | 4.37e-36 | 8rb8:E, 8rb9:E, 8rbm:E, 8rbq:E |
4 | 7zc6:A | 191 | 148 | 0.2525 | 0.2670 | 0.3446 | 1.25e-13 | |
5 | 8ahx:A | 189 | 151 | 0.1832 | 0.1958 | 0.2450 | 1.60e-08 | 8rb8:A, 8rb9:A, 8rbm:A, 8rbq:A |
6 | 8evu:E | 198 | 140 | 0.1832 | 0.1869 | 0.2643 | 4.29e-07 | 8a1t:E, 8a1u:E, 8a1v:E, 8a1w:E, 8a1x:E, 8a1y:E, 8acw:E, 8acy:E, 8ad0:E, 8ew3:E, 7xk3:E, 7xk4:E, 7xk5:E, 7xk6:E, 7xk7:E |
7 | 1j32:A | 388 | 39 | 0.0743 | 0.0387 | 0.3846 | 0.006 | 1j32:B |
8 | 5bnt:C | 371 | 63 | 0.0891 | 0.0485 | 0.2857 | 1.1 | 5bnt:B, 5bnt:A, 5bnt:D |
9 | 4v8k:AM | 319 | 42 | 0.0743 | 0.0470 | 0.3571 | 5.8 | 5b5m:M, 5b5m:y, 5b5n:M, 5b5n:y, 7c52:M, 1eys:M, 4v8k:BM, 7vrj:M, 8wdu:M, 8wdv:M, 3wmm:M, 5y5s:M |
10 | 7myj:C | 465 | 34 | 0.0693 | 0.0301 | 0.4118 | 6.2 | 3aqv:A, 6b1u:C, 6b2e:A, 8bik:A, 8bik:D, 5iso:A, 4zhx:C |
11 | 7dr0:F | 161 | 59 | 0.0792 | 0.0994 | 0.2712 | 7.0 | 7dr1:F, 7dr2:aF, 7dr2:bF, 7dr2:cF, 7dr2:dF |
12 | 1gd9:A | 388 | 53 | 0.0594 | 0.0309 | 0.2264 | 7.4 | 1dju:A, 1dju:B, 1gd9:B, 1gde:A, 1gde:B |
13 | 5xy3:k | 68 | 30 | 0.0495 | 0.1471 | 0.3333 | 9.2 | |
14 | 6qdj:A | 758 | 40 | 0.0693 | 0.0185 | 0.3500 | 9.3 |