KKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQ
LVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPP
The query sequence (length=138) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8g0h:C | 227 | 136 | 0.9855 | 0.5991 | 1.0000 | 3.29e-97 | 4av1:A, 4av1:C, 4dqy:D, 4dqy:A, 4dqy:B, 4dqy:E, 8g0h:A, 2jvn:A, 3od8:A, 3od8:B, 3od8:C, 3od8:E, 3od8:G, 3od8:H, 3oda:A, 3oda:B, 3oda:C, 3oda:E, 3oda:G, 3oda:H, 4opx:D, 4opx:A, 4oqa:D, 4oqa:A, 4oqb:D, 4oqb:A, 2riq:A, 7s68:A, 7s6h:C, 7s6h:A, 7s6m:A, 7s6m:C, 7s81:I, 7s81:F, 7s81:G, 7s81:O, 7s81:J, 7s81:B |
2 | 2w4l:C | 142 | 104 | 0.1594 | 0.1549 | 0.2115 | 0.45 | |
3 | 6hjw:B | 245 | 46 | 0.0870 | 0.0490 | 0.2609 | 1.9 | 6hjw:A |
4 | 7b1s:C | 265 | 63 | 0.1304 | 0.0679 | 0.2857 | 4.9 | 7b1s:F, 7b2c:C, 7b2c:F |
5 | 8sq0:A | 1402 | 42 | 0.1087 | 0.0107 | 0.3571 | 7.1 | 8sq0:B, 8sql:A, 8sqm:A |
6 | 4yd9:A | 1656 | 37 | 0.0870 | 0.0072 | 0.3243 | 8.3 | 4yd9:D, 4yd9:G, 4yd9:J, 4yd9:M, 4yd9:P, 4yd9:S, 4yd9:V, 4yd9:Y, 4yd9:b |
7 | 5tjg:D | 1475 | 44 | 0.1159 | 0.0108 | 0.3636 | 8.4 | |
8 | 4xln:J | 1367 | 44 | 0.1159 | 0.0117 | 0.3636 | 8.7 | 3aoh:D, 3aoh:N, 3aoi:D, 3aoi:N, 6asg:D, 4gzy:D, 4gzz:D, 5i2d:D, 5i2d:O, 4mq9:D, 7rdq:D, 4wqt:D, 4wqt:I, 4wqt:N, 4xlp:J, 4xlq:J, 4xlr:J, 4xls:J |
9 | 2buf:C | 298 | 111 | 0.2174 | 0.1007 | 0.2703 | 10.0 | 2buf:A, 2buf:B, 2buf:D, 2buf:E, 2buf:F, 2buf:G, 2buf:H, 2buf:I, 2buf:J, 2buf:L |