KKRLTESQFQEAIQGLEVGQQTIEIARGVLVDGKPQATFATSLGLTRGAVSQAVHRVWAAFEDKNLPEGYARVTAVLPEH
QAYIVRKWEADAKKKQ
The query sequence (length=96) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8qa9:C | 107 | 96 | 1.0000 | 0.8972 | 1.0000 | 6.35e-67 | 5clv:A, 5clv:B, 5clv:E, 5clv:F, 5clv:I, 5clv:J, 5clv:M, 5clv:N, 5cm3:A, 5cm3:B, 8qa9:D, 2w7n:A, 2w7n:B |
2 | 7bcb:B | 97 | 76 | 0.3438 | 0.3402 | 0.4342 | 5.10e-07 | 7bca:A, 7bca:B, 7bcb:A |
3 | 7w5s:A | 302 | 45 | 0.1667 | 0.0530 | 0.3556 | 1.1 | 7w5t:A, 7w5v:A |
4 | 5i10:A | 192 | 63 | 0.2188 | 0.1094 | 0.3333 | 2.8 | |
5 | 3szm:C | 191 | 42 | 0.1354 | 0.0681 | 0.3095 | 4.3 | 3shv:A, 3shv:B, 3szm:A, 3szm:B, 3szm:D, 3szm:E, 3szm:F, 3szm:G, 3szm:H, 3t1n:A, 3t1n:B, 3u3z:A |
6 | 8hvc:A | 602 | 59 | 0.1667 | 0.0266 | 0.2712 | 4.4 | 8hvb:A, 8hvd:A |
7 | 6iub:A | 264 | 30 | 0.1042 | 0.0379 | 0.3333 | 5.0 | 6iub:B, 6iuc:A, 6iuc:B, 6iuc:C, 6iuc:D, 6iud:B, 6iud:C, 6iud:D, 6iud:A, 8jmj:A, 8jmj:B, 8jmj:C, 8jmj:D, 8jmk:A, 8jmk:B, 8jmk:C, 8jmk:D, 8jml:A, 8jml:B |
8 | 8agd:A | 1111 | 45 | 0.1458 | 0.0126 | 0.3111 | 5.8 | 8acq:A, 8acq:C, 8acq:B, 8ae1:A, 8ae1:B, 8ae1:C, 8agd:C, 8agd:B, 7zgy:A, 7zgy:C, 7zgy:B |
9 | 8p2f:1 | 61 | 24 | 0.0938 | 0.1475 | 0.3750 | 7.2 | 7asm:V, 7asn:V, 7aso:c, 7asp:V, 6ddd:J, 6ddg:J, 6fxc:AV, 6fxc:BV, 5hkv:U, 5hl7:U, 6hma:V, 5li0:0, 5nd8:0, 5nd9:0, 5ngm:AV, 7nhl:1, 7nhm:1, 8p2g:1, 8p2h:1, 7p48:V, 6s0x:V, 6s0z:V, 6s12:V, 6s13:V, 6sj6:0, 5t7v:LA, 5tcu:LA, 7ttu:J, 7ttw:J, 4wce:U, 4wfa:U, 4wfb:U, 6wqn:J, 6wqq:J, 6wrs:J, 6wru:J, 8y36:V, 8y37:V, 8y38:V, 8y39:V, 6yef:0 |
10 | 5dw8:A | 260 | 20 | 0.0938 | 0.0346 | 0.4500 | 7.9 | 5dw8:B, 5j16:A, 5j16:B, 5j16:C, 5j16:D |
11 | 7qd1:A | 311 | 22 | 0.1354 | 0.0418 | 0.5909 | 8.0 | 7qcz:A, 7qd0:A, 7qd1:C, 7qd2:A, 7qd2:C |
12 | 8dek:B | 441 | 43 | 0.1458 | 0.0317 | 0.3256 | 8.4 | 8dek:A, 8df2:A, 8df2:B, 8df2:C, 8df2:D |
13 | 8qx5:A | 158 | 26 | 0.1354 | 0.0823 | 0.5000 | 9.8 | 8qx5:B |