BioLiP

>protein
KKKRKNPDLGFSDYAAAQLRQYHRLTKQIKPDMETYERLREKHGEEFFPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKR
DKYSRRRPYNDDADIDYINERNAKFNKKAERFYGKYTAEIKQNLERGTAV

The query sequence (length=130) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	9fmd:M	224	130	1.0000	0.5804	1.0000	3.89e-95	8c6j:y, 8i0u:M, 8i0v:M, 8i0w:M, 6icz:M, 6id0:M, 6id1:M, 5mqf:N, 6qdv:y, 8ro2:M, 7w59:M, 7w5a:M, 7w5b:M, 5xjc:M, 5yzg:M
2	8ro0:M	196	120	0.4154	0.2755	0.4500	7.09e-26	8ro1:M
3	8sl7:D	544	37	0.1000	0.0239	0.3514	3.1	8sl7:A, 8sl7:B, 8sl7:C
4	1zfj:A	476	69	0.1385	0.0378	0.2609	3.7
5	5kwk:B	457	35	0.0846	0.0241	0.3143	3.7	5koe:A, 5kor:B, 5kor:C, 5kor:A, 5kor:D, 5kwk:A, 5kx6:A, 5kx6:B
6	4gir:B	411	62	0.1308	0.0414	0.2742	4.0	4ggh:A, 4ggh:B, 4ggh:C, 4ggh:D, 4gir:A, 4gir:C, 4gir:D, 4gis:A, 4gis:B
7	3c6k:D	348	62	0.1462	0.0546	0.3065	5.3	3c6k:A, 3c6k:B, 3c6k:C, 3c6m:A, 3c6m:B, 3c6m:C, 3c6m:D
8	1l4a:B	82	48	0.1154	0.1829	0.3125	5.4
9	3hd7:B	98	54	0.1231	0.1633	0.2963	5.8	3rk2:B, 5w5c:B
10	6pxs:A	370	46	0.1000	0.0351	0.2826	6.1	6pxs:B, 6pxs:C, 6pxs:D
11	6mvf:A	643	46	0.1154	0.0233	0.3261	7.7	6mvf:B, 6mvf:C, 6mvf:D, 6mvf:E, 6mvf:F
12	3jb9:Y	261	128	0.2692	0.1341	0.2734	9.1

[Back]