KKKRKNPDLGFSDYAAAQLRQYHRLTKQIKPDMETYERLREKHGEEFFPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKR
DKYSRRRPYNDDADIDYINERNAKFNKKAERFYG
The query sequence (length=114) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 9fmd:M | 224 | 114 | 1.0000 | 0.5089 | 1.0000 | 9.98e-83 | 8c6j:y, 8i0u:M, 8i0v:M, 8i0w:M, 6icz:M, 6id0:M, 6id1:M, 5mqf:N, 6qdv:y, 8ro2:M, 7w59:M, 7w5a:M, 7w5b:M, 5xjc:M, 5yzg:M |
2 | 8ro0:M | 196 | 105 | 0.3772 | 0.2194 | 0.4095 | 7.63e-18 | 8ro1:M |
3 | 6pxs:A | 370 | 46 | 0.1140 | 0.0351 | 0.2826 | 2.0 | 6pxs:B, 6pxs:C, 6pxs:D |
4 | 8sl7:D | 544 | 37 | 0.1140 | 0.0239 | 0.3514 | 2.1 | 8sl7:A, 8sl7:B, 8sl7:C |
5 | 1zfj:A | 476 | 69 | 0.1579 | 0.0378 | 0.2609 | 2.2 | |
6 | 5kwk:B | 457 | 35 | 0.0965 | 0.0241 | 0.3143 | 3.2 | 5koe:A, 5kor:B, 5kor:C, 5kor:A, 5kor:D, 5kwk:A, 5kx6:A, 5kx6:B |
7 | 4gir:B | 411 | 62 | 0.1491 | 0.0414 | 0.2742 | 3.3 | 4ggh:A, 4ggh:B, 4ggh:C, 4ggh:D, 4gir:A, 4gir:C, 4gir:D, 4gis:A, 4gis:B |
8 | 1l4a:B | 82 | 48 | 0.1316 | 0.1829 | 0.3125 | 4.5 | |
9 | 6mvf:A | 643 | 46 | 0.1316 | 0.0233 | 0.3261 | 6.0 | 6mvf:B, 6mvf:C, 6mvf:D, 6mvf:E, 6mvf:F |
10 | 3jb9:Y | 261 | 128 | 0.3070 | 0.1341 | 0.2734 | 6.9 | |
11 | 8sts:A | 533 | 54 | 0.1404 | 0.0300 | 0.2963 | 8.0 | 4b3p:A, 6bsi:B, 3kk3:B, 1lw2:A, 7so6:A, 8u6h:C, 8u6t:B |
12 | 5myj:BG | 176 | 36 | 0.0877 | 0.0568 | 0.2778 | 8.0 |