KKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQSGVGALFNGINALNAYNAALLAKILKVSVEEFSPSIAR
EIYEMYEAVSDAKRIEGFTLSEEILKSDKQLSVDAQFFTKPLTDGMAIRSEGKIYFVDKQASLSDGLWLVDIEGAISIRE
LTKLPGRKLHVAGGKVPFECGIDDIKTLGRVVGVYSEVN
The query sequence (length=199) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7jvt:D | 199 | 199 | 1.0000 | 1.0000 | 1.0000 | 3.04e-145 | 7jvt:C |
2 | 3bdn:A | 234 | 90 | 0.4523 | 0.3846 | 1.0000 | 3.93e-57 | 3bdn:B, 2hnf:A, 2ho0:A, 1lli:A, 1lli:B, 1lmb:3, 1lmb:4, 1rio:A, 1rio:B |
3 | 3woa:A | 413 | 110 | 0.3065 | 0.1477 | 0.5545 | 3.15e-22 | |
4 | 8tac:B | 66 | 47 | 0.0804 | 0.2424 | 0.3404 | 6.83e-04 | |
5 | 8i4a:A | 1218 | 65 | 0.1005 | 0.0164 | 0.3077 | 0.32 | 8bwo:A, 8i4c:A, 8j3w:A, 8j3z:A, 8xol:A, 8xom:A |
6 | 8iza:A | 1246 | 65 | 0.1005 | 0.0161 | 0.3077 | 0.33 | 8iz7:A, 8iz9:A, 8xok:A |
7 | 8bjf:A | 1195 | 62 | 0.0955 | 0.0159 | 0.3065 | 2.5 | 8bwp:A, 8bwq:A, 8bwr:A, 8sx7:A, 8sx8:A, 8sxb:A |
8 | 4ab7:H | 422 | 23 | 0.0603 | 0.0284 | 0.5217 | 4.3 | 4ab7:D, 3zzf:A, 3zzf:B, 3zzf:C, 3zzf:D, 3zzh:A, 3zzh:B, 3zzh:C, 3zzh:D |
9 | 2bji:A | 274 | 30 | 0.0653 | 0.0474 | 0.4333 | 5.9 | 2bji:B |
10 | 4as5:A | 274 | 30 | 0.0653 | 0.0474 | 0.4333 | 6.1 | 4as5:B, 4as5:C, 4as5:D |
11 | 5xyi:N | 150 | 61 | 0.0754 | 0.1000 | 0.2459 | 8.3 | |
12 | 7plb:B | 289 | 60 | 0.0804 | 0.0554 | 0.2667 | 9.2 | 7plb:A, 7plc:A, 7plc:D, 7plc:B, 7plc:C, 7pld:A, 7pld:B |
13 | 2or1:L | 63 | 29 | 0.0603 | 0.1905 | 0.4138 | 9.8 | 2or1:R, 1per:L, 1per:R, 1rpe:L, 1rpe:R |