BioLiP

>protein
KKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQSGVGALFNGINALNAYNAALLAKILKVSVEEFSPSIAR
EIYEMYEAVSDAKRIEGFTLSEEILKSDKQLSVDAQFFTKPLTDGMAIRSEGKIYFVDKQASLSDGLWLVDIEGAISIRE
LTKLPGRKLHVAGGKVPFECGIDDIKTLGRVVGVYSEVN

The query sequence (length=199) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7jvt:D	199	199	1.0000	1.0000	1.0000	3.04e-145	7jvt:C
2	3bdn:A	234	90	0.4523	0.3846	1.0000	3.93e-57	3bdn:B, 2hnf:A, 2ho0:A, 1lli:A, 1lli:B, 1lmb:3, 1lmb:4, 1rio:A, 1rio:B
3	3woa:A	413	110	0.3065	0.1477	0.5545	3.15e-22
4	8tac:B	66	47	0.0804	0.2424	0.3404	6.83e-04
5	8i4a:A	1218	65	0.1005	0.0164	0.3077	0.32	8bwo:A, 8i4c:A, 8j3w:A, 8j3z:A, 8xol:A, 8xom:A
6	8iza:A	1246	65	0.1005	0.0161	0.3077	0.33	8iz7:A, 8iz9:A, 8xok:A
7	8bjf:A	1195	62	0.0955	0.0159	0.3065	2.5	8bwp:A, 8bwq:A, 8bwr:A, 8sx7:A, 8sx8:A, 8sxb:A
8	4ab7:H	422	23	0.0603	0.0284	0.5217	4.3	4ab7:D, 3zzf:A, 3zzf:B, 3zzf:C, 3zzf:D, 3zzh:A, 3zzh:B, 3zzh:C, 3zzh:D
9	2bji:A	274	30	0.0653	0.0474	0.4333	5.9	2bji:B
10	4as5:A	274	30	0.0653	0.0474	0.4333	6.1	4as5:B, 4as5:C, 4as5:D
11	5xyi:N	150	61	0.0754	0.1000	0.2459	8.3
12	7plb:B	289	60	0.0804	0.0554	0.2667	9.2	7plb:A, 7plc:A, 7plc:D, 7plc:B, 7plc:C, 7pld:A, 7pld:B
13	2or1:L	63	29	0.0603	0.1905	0.4138	9.8	2or1:R, 1per:L, 1per:R, 1rpe:L, 1rpe:R

[Back]