BioLiP

>protein
KKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITDL
NDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRS

The query sequence (length=127) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2uyk:C	127	127	1.0000	1.0000	1.0000	4.03e-91	2uyn:A, 2uyn:B, 2uyn:C
2	3vcz:B	127	126	0.7165	0.7165	0.7222	2.28e-65
3	2b33:B	126	127	0.4882	0.4921	0.4882	2.44e-40
4	8yrc:A	125	123	0.4961	0.5040	0.5122	4.09e-40
5	7cd4:A	124	124	0.4567	0.4677	0.4677	2.47e-38	7cd4:C
6	5v4d:A	127	125	0.4016	0.4016	0.4080	2.26e-31	5v4d:B, 5v4d:E
7	3k0t:C	124	125	0.4016	0.4113	0.4080	4.96e-31	3k0t:A, 3k0t:B
8	5hp8:A	108	108	0.3307	0.3889	0.3889	7.39e-21	5hp8:B, 5hp8:C
9	9bk4:A	116	104	0.2677	0.2931	0.3269	1.54e-10	9bjy:A, 9bk4:B, 9bk8:A
10	3lyb:B	137	128	0.2835	0.2628	0.2812	7.96e-08
11	3i3f:A	131	102	0.2126	0.2061	0.2647	2.87e-05	3i3f:B, 3i3f:C
12	8wg4:A	688	50	0.1260	0.0233	0.3200	0.65
13	8ox6:A	575	80	0.1575	0.0348	0.2500	2.1
14	8ox4:A	870	80	0.1575	0.0230	0.2500	2.2
15	7vgh:B	1183	80	0.1575	0.0169	0.2500	2.2	7vgi:B
16	2f4l:C	278	99	0.2126	0.0971	0.2727	2.4	2f4l:A, 2f4l:B, 2f4l:D
17	4tlg:A	396	55	0.1417	0.0455	0.3273	3.0	4tlg:B
18	1w0m:A	225	67	0.1890	0.1067	0.3582	3.2	1w0m:B, 1w0m:C, 1w0m:D, 1w0m:E, 1w0m:F, 1w0m:G, 1w0m:H
19	2jda:B	142	19	0.0709	0.0634	0.4737	6.4	2jd9:A, 2jda:A

[Back]