BioLiP

>protein
KKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLH
YCKSQAWG

The query sequence (length=88) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4naw:A	88	88	1.0000	1.0000	1.0000	4.42e-62	4naw:E, 4naw:I, 4naw:M
2	7eu4:C	94	88	0.4432	0.4149	0.4432	3.78e-22	7eu4:A, 7eu4:E, 7eu4:G
3	3h9d:B	116	69	0.2045	0.1552	0.2609	0.019
4	5cx3:A	119	76	0.2159	0.1597	0.2500	0.020	5cx3:B, 5cx3:C, 5cx3:D, 7r9w:A, 7r9z:A, 7ra0:A, 6tbe:A
5	5l83:B	112	72	0.2159	0.1696	0.2639	0.023	5l83:A
6	3dow:A	119	80	0.2614	0.1933	0.2875	0.094	6a9x:D, 8afi:E, 8afi:G, 8afi:A, 8afi:I, 8afi:M, 8afi:O, 8afi:C, 8afi:K, 7bv4:A, 7bv4:E, 7bv4:B, 7bv4:G, 3d32:A, 3d32:B, 7ea7:B, 7fb5:A, 8t2n:A, 8t2n:C, 8t31:A, 8t31:C, 8t31:E, 8t31:G, 8t31:I, 8t32:A, 8t33:A, 7vec:A, 7vec:B, 7vec:C, 7vec:D, 7vec:E, 7vec:F, 7vec:G, 7vec:H, 7vec:I, 7vec:J, 7vec:L, 8w6a:A, 8w6a:G, 8w6a:B, 8w6a:D, 3wim:A, 4xc2:A, 4xc2:B, 4xc2:C, 4xc2:D, 5yir:D, 5yir:A, 5yir:B, 7zkr:A, 7zl7:C, 7zl7:A
7	5yip:A	123	76	0.2273	0.1626	0.2632	0.096	7aa7:A, 7aa7:B, 7aa9:A, 7aa9:E, 7aa9:C, 7aa9:I, 7aa9:G, 7aa9:K, 7cdb:A, 7cdb:B, 6hoi:B, 6hoi:A, 6hol:A, 6hol:B, 7jhx:A, 7jhx:B, 2l8j:A, 5lxh:A, 5lxh:B, 5lxh:C, 5lxi:D, 5lxi:B, 8x8a:A, 6yoo:A
8	7brn:A	133	77	0.2045	0.1353	0.2338	0.14	3vxw:A, 6wy6:A, 6wy6:B, 2zpn:A, 2zpn:D, 2zpn:B, 2zpn:C
9	6aaf:A	112	73	0.2273	0.1786	0.2740	0.21
10	1js3:A	464	60	0.2045	0.0388	0.3000	0.86	1js3:B, 1js6:A, 1js6:B
11	6h8c:A	116	90	0.2273	0.1724	0.2222	0.97
12	5e6o:A	117	76	0.2159	0.1624	0.2500	1.5	5e6o:B, 5e6o:C, 5e6o:D
13	3wrg:A	658	46	0.1591	0.0213	0.3043	3.7	7bzl:A, 7dif:A, 7exu:A, 7exv:A, 7exw:A, 8qf2:A, 3wkx:A, 3wre:A
14	1ya6:A	380	61	0.2159	0.0500	0.3115	3.8	1y8z:B, 1ya6:B
15	1jba:A	189	37	0.1591	0.0741	0.3784	4.1
16	1nxj:A	156	25	0.1364	0.0769	0.4800	6.5	1nxj:B, 1nxj:C
17	1xv5:A	401	61	0.2159	0.0474	0.3115	7.3	1y6f:A, 1y6f:B, 1y6g:A, 1y6g:B, 1y8z:A
18	7c5o:O	338	36	0.1477	0.0385	0.3611	7.5	7c5f:O, 7c5f:P, 7c5f:Q, 7c5f:R, 7c5g:O, 7c5g:P, 7c5g:Q, 7c5g:R, 7c5h:O, 7c5h:P, 7c5h:Q, 7c5h:R, 7c5i:O, 7c5i:P, 7c5i:Q, 7c5i:R, 7c5j:O, 7c5j:P, 7c5j:Q, 7c5j:R, 7c5k:O, 7c5k:P, 7c5k:Q, 7c5k:R, 7c5l:O, 7c5l:P, 7c5l:Q, 7c5l:R, 7c5m:O, 7c5m:P, 7c5m:Q, 7c5m:R, 7c5n:O, 7c5n:P, 7c5n:Q, 7c5n:R, 7c5o:P, 7c5o:Q, 7c5o:R, 7c5p:O, 7c5p:P, 7c5p:Q, 7c5p:R, 7c5q:O, 7c5q:P, 7c5q:Q, 7c5q:R, 7c5r:O, 7c5r:P, 7c5r:Q, 7c5r:R, 7c7k:O, 7c7k:P, 7c7k:Q, 7c7k:R
19	1ewq:A	759	14	0.0909	0.0105	0.5714	7.6	1ewq:B, 1fw6:A, 1fw6:B, 1nne:A, 1nne:B

[Back]