KKIDFKKEEKKFYAPKRKPERIFVPEMNFLMVDGKGDPDGEEYQKAVQSLYAIAYTIKMSKMGETRLDGYSDFVVPPLEG
FWWSEGKFDLKDRDAWLWTSILRQPDFVTEEVLEWAKEVARKKKPDVDTSRVKLVRFEEGECVQMMHVGPFSEAVHTVAE
MHQFMETEGLRNDTGAIRKHHLIYLSDPRKANPEKMKTILRLPVS
The query sequence (length=205) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 5x5m:A | 205 | 205 | 1.0000 | 1.0000 | 1.0000 | 7.43e-154 | 5x5m:B |
| 2 | 5ayk:A | 744 | 49 | 0.0878 | 0.0242 | 0.3673 | 6.0 | 5ayl:A |
umich.edu