KKFTDEQQQQLIGHLTKKGFYRGDIGNILYAERFLLPCIYLLDSVNYRTLCELAFKAIKQDDVLSKIIVRSVVSRLINER
KILQMTDGYQVTALGASYVRSVFDRKTLDRLRLEIMNFENRRKSTFNYDKIPY
The query sequence (length=133) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8qbk:G | 133 | 133 | 1.0000 | 1.0000 | 1.0000 | 6.45e-96 | 8qbk:F, 8qbl:G, 8qbm:G, 7v9x:C, 7xjg:C |
2 | 7xjg:J | 306 | 110 | 0.8271 | 0.3595 | 1.0000 | 5.83e-75 | 8qbk:E, 8qbk:T, 8qbl:E, 8qbl:F, 8qbl:H, 8qbl:T, 8qbm:E, 8qbm:T, 8qbm:F, 8qbm:H |
3 | 7xjg:J | 306 | 23 | 0.1729 | 0.0752 | 1.0000 | 3.44e-09 | 8qbk:E, 8qbk:T, 8qbl:E, 8qbl:F, 8qbl:H, 8qbl:T, 8qbm:E, 8qbm:T, 8qbm:F, 8qbm:H |
4 | 6xwl:C | 477 | 33 | 0.0977 | 0.0273 | 0.3939 | 4.1 | 6xwl:F, 6xwl:A, 6xwl:B, 6xwl:D, 6xwl:E, 6xyl:A, 6xyl:B, 6xyl:C, 6xyl:D, 6xyl:E, 6xyl:F, 6y21:D, 6y21:A, 6y21:B, 6z3s:D, 6z3s:A, 6z3s:B, 6zs7:D, 6zs7:A, 6zs7:B, 6zs7:C, 6zs7:E, 6zs7:F |
5 | 2y88:A | 244 | 26 | 0.0902 | 0.0492 | 0.4615 | 7.7 | 2y85:A, 2y85:B, 2y85:C, 2y85:D, 3zs4:A |
6 | 7dve:A | 498 | 30 | 0.0902 | 0.0241 | 0.4000 | 9.9 |