KKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNV
The query sequence (length=58) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2m7q:A | 69 | 58 | 1.0000 | 0.8406 | 1.0000 | 9.04e-39 | 4bmj:C, 4bmj:H, 4bmj:J, 5yt6:F, 5yt6:B, 5yt6:H |
2 | 4z4k:A | 282 | 54 | 0.9310 | 0.1915 | 1.0000 | 5.48e-36 | 5aas:A, 4bmj:A, 4bmj:B, 4bmj:D, 4bmj:E, 4bmj:F, 4bmj:G, 4bmj:I, 4bmj:K, 3vht:B, 5yt6:D, 4z4k:B, 4z4m:A, 4z4m:B |
3 | 2mdg:A | 55 | 42 | 0.2241 | 0.2364 | 0.3095 | 0.041 | |
4 | 7ns4:i | 358 | 30 | 0.2069 | 0.0335 | 0.4000 | 0.092 | |
5 | 7ns4:i | 358 | 26 | 0.1552 | 0.0251 | 0.3462 | 6.5 | |
6 | 2wbt:A | 125 | 35 | 0.2241 | 0.1040 | 0.3714 | 0.13 | 2wbt:B |
7 | 8pmq:9 | 412 | 30 | 0.2069 | 0.0291 | 0.4000 | 0.56 | |
8 | 2k5c:A | 88 | 70 | 0.3103 | 0.2045 | 0.2571 | 1.6 | |
9 | 7oje:A | 365 | 45 | 0.2414 | 0.0384 | 0.3111 | 1.7 | 7oje:C |
10 | 7oje:A | 365 | 25 | 0.1379 | 0.0219 | 0.3200 | 6.2 | 7oje:C |
11 | 6adi:A | 418 | 51 | 0.2069 | 0.0287 | 0.2353 | 1.8 | 6adi:B, 5h3e:B, 5h3f:A, 5h3f:B, 5i95:A, 5i96:A, 5i96:B, 4ja8:A, 4ja8:B, 5svn:A, 5svn:B, 5svo:A, 5svo:B, 6vfz:A, 6vfz:B |
12 | 1q17:C | 295 | 37 | 0.2069 | 0.0407 | 0.3243 | 2.6 | 7f4e:A, 7f51:A, 2od2:A, 2od7:A, 2od9:A, 1q14:A, 1q17:A, 1q17:B, 1q1a:A, 2qqf:A, 2qqg:A, 1szc:A, 1szd:A |
13 | 6thh:C | 816 | 12 | 0.1207 | 0.0086 | 0.5833 | 4.8 | 6yes:A |
14 | 2muq:A | 44 | 23 | 0.1379 | 0.1818 | 0.3478 | 5.0 | 2mur:A, 3wwq:C, 3wwq:F, 3wwq:I, 3wwq:L |
15 | 7olc:LL | 209 | 23 | 0.1379 | 0.0383 | 0.3478 | 5.7 | 8i9p:LL, 8i9r:LL, 8i9t:LL, 8i9v:LL, 8i9w:LL, 8i9x:LL, 8i9y:LL, 8i9z:LL, 8ia0:LL, 7old:LL, 8oo0:LL, 8pv1:LL, 8pv2:LL, 8pv3:LL, 8pv4:LL, 8pv5:LL, 8pv6:LL, 8pv7:LL, 8pv8:LL, 8pvk:LL, 8pvl:LL, 7z3n:LL, 7z3o:LL |
16 | 7r81:N1 | 213 | 23 | 0.1379 | 0.0376 | 0.3478 | 5.8 | |
17 | 6jyg:D | 307 | 28 | 0.2069 | 0.0391 | 0.4286 | 7.7 | 6jyg:A, 6jyg:B, 6jyg:C, 6jyg:E, 6jyg:F |
18 | 5vsu:A | 387 | 24 | 0.1552 | 0.0233 | 0.3750 | 8.4 | 6aso:A, 2kh9:A, 4n0t:A, 5tf6:A, 5tf6:C |
19 | 5aaq:A | 57 | 24 | 0.1897 | 0.1930 | 0.4583 | 8.7 | 2mxp:A, 4xkl:B, 4xkl:D |