BioLiP

>protein
KIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSAY
TTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFT
LARYAAMKEGNQEKIYMK

The query sequence (length=178) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7rut:E	187	178	0.9888	0.9412	0.9888	9.86e-129	6d5k:A, 6d5k:C, 6d5k:B, 6d5x:A, 6d5x:C, 6d5x:B, 2idx:A, 2idx:C, 2idx:B, 7rut:D, 7rut:C, 7rut:F, 7rut:B, 7rut:A, 7ruu:A, 7ruu:C, 7ruu:B, 7ruu:D, 7ruv:A, 7ruv:D, 7ruv:B, 7ruv:C
2	3ci1:A	188	179	0.4045	0.3830	0.4022	1.15e-40	3ci3:A, 3ci4:A, 3gah:A, 3gai:A, 3gaj:A, 2nt8:A, 2r6t:A, 2r6t:B, 2r6x:A, 2r6x:B
3	3ke5:A	182	166	0.3989	0.3901	0.4277	2.91e-34	3ke5:C, 3ke5:B
4	2zhz:B	174	177	0.3876	0.3966	0.3898	7.60e-34	2zhz:A, 2zhz:C
5	8d32:A	186	171	0.3539	0.3387	0.3684	9.85e-22	6wgs:A, 6wgv:A, 6wh5:A, 6wh5:B, 6wh5:C
6	8joz:A	257	59	0.1124	0.0778	0.3390	2.5	4htf:A, 4htf:B
7	8h0s:C	190	134	0.1910	0.1789	0.2537	5.5	8h0s:A, 8h0t:A, 4poo:A
8	7n6e:I	199	64	0.0843	0.0754	0.2344	7.3	7n6e:G, 7pbe:D, 7pbe:I, 3sjv:D, 3sjv:I, 3sjv:N, 3sjv:S, 8ye4:G, 8ye4:I
9	8h0s:B	171	79	0.1292	0.1345	0.2911	9.4	8h0s:D, 4poo:B
10	3vkh:B	2908	108	0.1461	0.0089	0.2407	9.9

[Back]