BioLiP

>protein
KIYTKNGDKGQTRIIGKQILYKNDPRVAAYGEVDELNSWVGYTKSLINSHTQVLSNELEEIQQLLFDCGHDLATPADDER
HSFKFKQEQPTVWLEEKIDNYTQVVPAVKKHILPGGTQLASALHVARTITRRAERQIVQLMREEQINQDVLIFINRLSDY
FFAAARYANYLEQQPDMLYRNSKDVF

The query sequence (length=186) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3ci1:A	188	186	0.9946	0.9840	0.9946	2.71e-139	3ci3:A, 3ci4:A, 3gah:A, 3gai:A, 3gaj:A, 2nt8:A, 2r6t:A, 2r6t:B, 2r6x:A, 2r6x:B
2	3ke5:A	182	184	0.4570	0.4670	0.4620	3.87e-47	3ke5:C, 3ke5:B
3	7rut:E	187	179	0.3763	0.3743	0.3911	9.36e-37	6d5k:A, 6d5k:C, 6d5k:B, 6d5x:A, 6d5x:C, 6d5x:B, 2idx:A, 2idx:C, 2idx:B, 7rut:D, 7rut:C, 7rut:F, 7rut:B, 7rut:A, 7ruu:A, 7ruu:C, 7ruu:B, 7ruu:D, 7ruv:A, 7ruv:D, 7ruv:B, 7ruv:C
4	2zhz:B	174	182	0.3602	0.3851	0.3681	1.91e-28	2zhz:A, 2zhz:C
5	8d32:A	186	183	0.3656	0.3656	0.3716	5.25e-27	6wgs:A, 6wgv:A, 6wh5:A, 6wh5:B, 6wh5:C
6	2eix:A	243	59	0.0806	0.0617	0.2542	0.47	2eix:B
7	2uvp:C	186	34	0.0645	0.0645	0.3529	1.5	2uvp:B
8	9cpo:A	930	105	0.1452	0.0290	0.2571	1.6
9	1jq5:A	366	78	0.1129	0.0574	0.2692	2.9	1jpu:A, 1jqa:A
10	4o6m:B	341	69	0.0914	0.0499	0.2464	3.1	4o6m:A, 4o6n:A, 4o6n:B, 4q7c:A, 4q7c:B
11	9ezy:B	657	116	0.1290	0.0365	0.2069	5.8
12	8u3k:E	669	116	0.1290	0.0359	0.2069	5.9	8u0j:A

[Back]