KISTEVGITNVDLSTVDKPKTTRVTYPAKAKGTFIAFALFFQLVDVNTGAELTPHQTFVRLHNQKTGQEVVFVAEPDNKN
VYKFELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVVIKFPNLFTPKQEIQHLFREPEKRPPTVVSNTFTAL
ILSPLLLLFALWIRIGANVSNFTFAPSTIIFHLGHAAMLGLMYVYWTQLNMFQTLKYLAILGSVTFLAGNRMLAQQAVKR
T
The query sequence (length=241) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6s7t:F | 250 | 250 | 0.9917 | 0.9560 | 0.9560 | 1.06e-171 | 8pn9:F, 6s7o:F |
2 | 6ezn:H | 259 | 106 | 0.1162 | 0.1081 | 0.2642 | 0.20 | 8agb:F, 8agc:F, 8age:F, 7oci:H |
3 | 2uzk:A | 97 | 26 | 0.0373 | 0.0928 | 0.3462 | 4.3 | 2uzk:C |
4 | 6zpa:A | 173 | 63 | 0.0871 | 0.1214 | 0.3333 | 4.4 | 6zpb:A, 6zpc:A |