BioLiP

>protein
KISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKAVTILHKGFSASVRTILQNDH
SLLASSWASAELHAPPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTEECQEYS
KDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIRPFDQLFALHAIDQINPPLNVTAEIEGTRLSIQWEKPVSAFP
IHCFDYEVKIHNTRNGYLQIEKLMTNAFISIIDDLSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGFSR

The query sequence (length=309) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6h41:A	309	309	1.0000	1.0000	1.0000	0.0	3qt2:B
2	5uwc:G	253	216	0.2071	0.2530	0.2963	2.36e-09
3	3vmm:A	471	49	0.0550	0.0361	0.3469	0.059	3wnz:A, 3wo0:A, 3wo1:A
4	6dg5:B	206	162	0.1294	0.1942	0.2469	0.072
5	6iaa:A	815	142	0.1165	0.0442	0.2535	0.13	6iaa:B
6	4nzd:A	210	101	0.0841	0.1238	0.2574	0.31	4nzd:B, 4nzd:C, 3tgx:A, 3tgx:C, 3tgx:E, 3tgx:G, 3tgx:I, 3tgx:K, 3tgx:O, 3tgx:M
7	1eba:A	212	108	0.0712	0.1038	0.2037	1.5	1eba:B, 1ebp:A, 1ebp:B
8	8fpj:A	1345	42	0.0421	0.0097	0.3095	3.1
9	2gys:B	406	183	0.1294	0.0985	0.2186	4.9
10	3a09:A	490	44	0.0453	0.0286	0.3182	6.0	3vlu:A, 3vlv:A, 3vlw:A, 3vlw:B, 1y3n:A, 1y3p:A, 1y3q:A
11	9cj0:A	170	42	0.0453	0.0824	0.3333	8.7
12	2iv9:A	236	131	0.1003	0.1314	0.2366	9.3	2g30:A, 3h1z:A, 3hs9:A, 2iv8:A, 2iv9:B

[Back]