KIEMNFLNKPIVPDTTKVISNFLTHYLITEPVEHVEIEAKLGTLIDLETQNRFEFPVMNETILNPEFNLRTRFESDMTAS
EHKYLNEFLNQAFRDSQKPGRLPFAYKHTKQVDLFYETEDNSRDKIRVSKNQSDNQVLACVKKRRVADLFLYCPNDAFDI
RISISDELPVSMPSGNQQPSLTRLKDRVGYVHQEIKIDLTKTTQNTTERHELEVEFGNIADLRDRAQKAKDGMEAPLFRR
VQLFMDNVRILRREHS
The query sequence (length=256) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4pn1:B | 261 | 261 | 0.9844 | 0.9655 | 0.9655 | 0.0 | 4pn1:A, 4pn1:C, 4pn1:D |
2 | 1d8h:A | 288 | 271 | 0.3203 | 0.2847 | 0.3026 | 1.12e-20 | 1d8h:B, 1d8h:C, 1d8i:A, 1d8i:B, 1d8i:C |
3 | 6l7x:A | 203 | 88 | 0.0938 | 0.1182 | 0.2727 | 2.63e-05 | 6l7w:A, 6l7y:A |
4 | 6l7v:A | 180 | 98 | 0.1016 | 0.1444 | 0.2653 | 7.78e-05 | 6l7w:B |
5 | 6qf7:B | 244 | 25 | 0.0469 | 0.0492 | 0.4800 | 1.7 | 6b74:B, 6b77:B, 6l63:A, 6l63:C, 6qf7:D, 8r8d:B, 8r8d:A, 6x0s:A, 6x0s:B, 6x0s:C, 6x0t:A, 6x0t:B, 6x0t:C |
6 | 5xs2:A | 366 | 53 | 0.0664 | 0.0464 | 0.3208 | 1.8 | 5cei:A, 5hbe:A, 5icp:A, 5idp:A, 6r3s:A, 6t41:A, 6y0a:A |
7 | 7qfw:B | 94 | 61 | 0.0742 | 0.2021 | 0.3115 | 2.2 | 7q2z:C |
8 | 8tun:C | 258 | 88 | 0.0938 | 0.0930 | 0.2727 | 2.8 | 8tt3:C, 8tt3:D, 8tun:D |
9 | 6dtq:A | 391 | 50 | 0.0586 | 0.0384 | 0.3000 | 3.8 | 6dtq:B, 6dtq:C, 6dtq:D |
10 | 6ayi:A | 183 | 78 | 0.0703 | 0.0984 | 0.2308 | 5.7 | 6ayi:B, 6ayi:C, 6ayi:D |