KIEMNFLNKPIVPDTTKVISNFLTHYLITEPVEHVEIEAKLGTLIDLETQNRFEFPVMNETILNPEFNLRTRFESDMTAS
EHKYLNEFLNQAFRDSQKPGRLPFAYKHTKQVDLFYETEDNDKIRVSKNQSDNQVLACVKKRRVADLFLYCPNDAFDIRI
SISDELPVSMPSGNQQPSLTRLKDRVGYVHQEIKIDLTKTTQNDPVYDTTERHELEVEFGNIADLRDRAQKAKDGMEAPL
FRRVQLFMDNVRILRREHS
The query sequence (length=259) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4pn1:B | 261 | 259 | 0.9923 | 0.9847 | 0.9923 | 0.0 | 4pn1:A, 4pn1:C, 4pn1:D |
2 | 1d8h:A | 288 | 274 | 0.3243 | 0.2917 | 0.3066 | 7.11e-19 | 1d8h:B, 1d8h:C, 1d8i:A, 1d8i:B, 1d8i:C |
3 | 6l7x:A | 203 | 93 | 0.0927 | 0.1182 | 0.2581 | 7.43e-04 | 6l7w:A, 6l7y:A |
4 | 6l7v:A | 180 | 91 | 0.0888 | 0.1278 | 0.2527 | 0.009 | 6l7w:B |
5 | 6qf7:B | 244 | 25 | 0.0463 | 0.0492 | 0.4800 | 1.7 | 6b74:B, 6b77:B, 6l63:A, 6l63:C, 6qf7:D, 8r8d:B, 8r8d:A, 6x0s:A, 6x0s:B, 6x0s:C, 6x0t:A, 6x0t:B, 6x0t:C |
6 | 5xs2:A | 366 | 53 | 0.0656 | 0.0464 | 0.3208 | 1.8 | 5cei:A, 5hbe:A, 5icp:A, 5idp:A, 6r3s:A, 6t41:A, 6y0a:A |
7 | 8tun:C | 258 | 88 | 0.0927 | 0.0930 | 0.2727 | 2.9 | 8tt3:C, 8tt3:D, 8tun:D |
8 | 5brp:A | 555 | 86 | 0.0772 | 0.0360 | 0.2326 | 4.2 | 5brp:B, 5brp:C, 5brp:D, 5brq:A, 5brq:B, 5brq:C, 5brq:D |
9 | 6ayi:A | 183 | 102 | 0.0811 | 0.1148 | 0.2059 | 5.5 | 6ayi:B, 6ayi:C, 6ayi:D |
10 | 7vfq:C | 397 | 224 | 0.1853 | 0.1209 | 0.2143 | 6.3 | 7vfq:A, 7vfq:B, 7vfq:D, 7vfr:A |
11 | 2vq1:B | 213 | 49 | 0.0656 | 0.0798 | 0.3469 | 8.7 | 2vq1:F |