KIAVLVVIYDHHQRELNQRMIDIQHASGTHVLCTTHIHMDEHNCLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKASS
F
The query sequence (length=81) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6mrj:B | 142 | 81 | 1.0000 | 0.5704 | 1.0000 | 4.47e-56 | 2cad:A, 2cad:B, 3lgh:A, 3lgh:B, 3lgh:C, 3lgh:D, 6mrj:A, 6mrj:C, 6mrj:D, 3pht:A, 3pht:B, 3qsi:B, 3qsi:C, 3qsi:D, 3qsi:A, 3qsi:F, 3qsi:G, 3qsi:H, 3qsi:E, 3qsi:I, 2wvf:B, 2y3y:A, 2y3y:B, 2y3y:C, 2y3y:D |
2 | 2bj7:B | 138 | 78 | 0.3086 | 0.1812 | 0.3205 | 4.82e-14 | 2bj1:A, 2bj1:B, 2bj7:A, 2bj8:A, 2bj8:B, 2bj9:A, 2bj9:B |
3 | 3od2:A | 132 | 74 | 0.2840 | 0.1742 | 0.3108 | 5.11e-09 | 3bkt:A, 3bkt:B, 3bkt:C, 3bkt:D, 2hza:A, 2hza:B, 2hzv:A, 2hzv:B, 2hzv:C, 2hzv:D, 2hzv:E, 2hzv:F, 2hzv:G, 2hzv:H, 3od2:B, 1q5y:A, 1q5y:C, 1q5y:B, 1q5y:D |
4 | 3bkf:A | 66 | 44 | 0.1605 | 0.1970 | 0.2955 | 0.004 | |
5 | 6z1p:BB | 110 | 54 | 0.1852 | 0.1364 | 0.2778 | 0.088 | |
6 | 2gam:C | 374 | 22 | 0.1605 | 0.0348 | 0.5909 | 2.5 | 2gam:A, 2gam:B, 2gam:D, 3otk:A, 3otk:B, 3otk:C, 3otk:D |
7 | 6qkb:A | 384 | 28 | 0.1358 | 0.0286 | 0.3929 | 4.3 | 6qkb:B |
8 | 5ucv:A | 187 | 48 | 0.1852 | 0.0802 | 0.3125 | 4.8 | |
9 | 1bmv:2 | 374 | 25 | 0.1481 | 0.0321 | 0.4800 | 7.5 | 1pgl:2 |
10 | 6sh3:A | 376 | 30 | 0.1235 | 0.0266 | 0.3333 | 9.4 | 6sh3:B, 6sh3:C, 6sh3:D, 6sh3:E, 6sh3:F, 6sh3:G |