KHSDEYKIRRERNNIAARKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPE
The query sequence (length=68) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 1h88:B | 71 | 68 | 0.9853 | 0.9437 | 0.9853 | 1.02e-42 | 2e42:A, 2e42:B, 2e43:A, 2e43:B, 1gtw:A, 1gtw:B, 1gu4:A, 1gu4:B, 1gu5:A, 1gu5:B, 1h88:A, 1h89:A, 1h89:B, 1h8a:A, 1h8a:B, 1hjb:A, 1hjb:B, 1hjb:D, 1hjb:E, 1io4:A, 1io4:B, 8k8d:A, 8k8d:B, 7l4v:A, 7l4v:B, 6mg1:A, 6mg1:B, 6mg2:A, 6mg2:B, 6mg3:A, 6mg3:B, 7upz:A, 7upz:B |
| 2 | 8k8c:A | 60 | 59 | 0.6618 | 0.7500 | 0.7627 | 7.00e-27 | 8k8c:B, 1nwq:A, 1nwq:C |
| 3 | 8k86:A | 63 | 51 | 0.2941 | 0.3175 | 0.3922 | 0.048 | 8k86:B, 8k8a:A, 8k8a:B |
| 4 | 1t2k:D | 61 | 53 | 0.2794 | 0.3115 | 0.3585 | 0.40 | |
| 5 | 2c9l:Y | 63 | 53 | 0.2647 | 0.2857 | 0.3396 | 0.68 | 2c9l:Z, 2c9n:Y, 2c9n:Z, 7nx5:A, 7nx5:B, 7nx5:E, 7nx5:F, 5szx:A, 5szx:B |
| 6 | 1ysa:C | 57 | 49 | 0.2647 | 0.3158 | 0.3673 | 0.69 | 1dgc:A, 2dgc:A, 1ysa:D |
| 7 | 6sdw:A | 177 | 68 | 0.2794 | 0.1073 | 0.2794 | 3.7 | 6htu:A, 6htu:B, 6htu:C, 6sdy:A |
| 8 | 6rm8:A | 655 | 31 | 0.1618 | 0.0168 | 0.3548 | 4.1 | 6fa5:A, 6faa:A, 6fac:A, 6rm9:A, 6rma:A, 6rmb:A, 6rmc:A, 6rmc:B, 6zm2:A |
| 9 | 5yp2:A | 724 | 15 | 0.1618 | 0.0152 | 0.7333 | 5.1 | 5yp2:B, 5yp3:A, 5yp3:B, 5yp3:C, 5yp3:D, 5yp4:A, 5yp4:B, 5yp4:C, 5yp4:D |
| 10 | 6hn5:F | 323 | 22 | 0.1618 | 0.0341 | 0.5000 | 5.1 | |
| 11 | 7yq5:E | 799 | 22 | 0.1618 | 0.0138 | 0.5000 | 6.0 | 7pg0:A, 7pg2:A, 7pg3:A, 7pg4:A, 7sl4:B, 7yq6:E, 7yq6:F |
| 12 | 8guy:F | 835 | 22 | 0.1618 | 0.0132 | 0.5000 | 6.4 | 6ce7:P, 6ce9:M, 6ce9:P, 6ceb:M, 6ceb:P, 8guy:E, 6hn5:E, 5j3h:E, 7kd6:E, 7kd6:K, 7kd6:Q, 7kd6:W, 5kqv:E, 5kqv:F, 7mqo:F, 7mqo:E, 7mqr:E, 7mqr:F, 4oga:E, 7pg0:B, 7pg2:B, 7pg3:B, 7pg4:B, 7qid:C, 7sl3:A, 7sl3:B, 6sof:A, 6sof:C, 7u6e:F, 7u6e:E, 6vep:E, 6vep:K, 6vep:Q, 6vep:W, 6veq:K, 6veq:E, 3w11:E, 3w12:E, 3w13:E, 4xss:E, 4xst:E, 7yq3:F, 7yq3:E, 7yq4:E, 7yq4:F, 7yq5:F |
| 13 | 7qep:S1 | 209 | 61 | 0.2647 | 0.0861 | 0.2951 | 6.7 | |
| 14 | 4v2i:A | 315 | 34 | 0.1912 | 0.0413 | 0.3824 | 7.1 | 4v2i:B |
| 15 | 2wt7:A | 63 | 49 | 0.2500 | 0.2698 | 0.3469 | 7.1 | 1a02:F, 1fos:E, 1fos:G, 1s9k:D |
| 16 | 4w2e:y | 644 | 42 | 0.2206 | 0.0233 | 0.3571 | 9.4 |
umich.edu