BioLiP

>protein
KHAEADLNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWPIKCSAPKYIDYLMT
WVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRE
LAPLQELIEKLTS

The query sequence (length=173) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5brk:A	194	178	0.9422	0.8402	0.9157	6.86e-120	5b5v:A, 5b5v:C, 5b5v:B, 5b5v:D, 5b5w:A, 5b6b:A, 5b6b:B, 5b6b:D, 5b6b:F, 5b6b:H, 5b6b:K, 5b6b:M, 5b6b:O, 5brm:A, 5brm:B, 5brm:C, 5brm:D, 5brm:E, 5brm:F, 4j1v:A, 4j1v:C, 4jiz:A, 6mcp:B, 6mcp:D, 6mcq:B, 6mcq:D, 1pi1:A, 5twf:A, 5twf:B, 5twg:A, 5twh:A, 5xqz:A, 5xqz:B
2	2hjn:A	206	169	0.5260	0.4417	0.5385	6.75e-62	5ncn:A
3	5ncm:A	183	165	0.4046	0.3825	0.4242	6.05e-49
4	7k36:H	177	147	0.2023	0.1977	0.2381	1.88e-05
5	5yf4:A	129	146	0.1908	0.2558	0.2260	0.20
6	6c0f:D	190	127	0.1676	0.1526	0.2283	0.90	6cb1:D, 8e5t:D, 6em1:3, 6em3:3, 6em4:3, 6em5:3, 7ohs:3, 7ohw:3, 7ohx:3, 8v83:R, 8v84:R, 5z3g:Z
7	7bjt:A	727	132	0.1676	0.0399	0.2197	1.2	7bjt:B, 7bm6:A, 7bm6:B
8	7oro:A	2008	59	0.0925	0.0080	0.2712	1.9	7ori:A
9	1rv3:B	466	60	0.0809	0.0300	0.2333	3.8	1cj0:A, 1ls3:A, 1ls3:B, 1ls3:C, 1ls3:D, 1rv3:A, 1rv4:A, 1rv4:B, 1rvu:A, 1rvu:B, 1rvy:A, 1rvy:B
10	2vea:A	500	42	0.0751	0.0260	0.3095	7.7

[Back]