KGRKLNYSVQDPIANYEAPITSGYKWSDDQIDEFFAG
The query sequence (length=37) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7suk:5 | 296 | 37 | 1.0000 | 0.1250 | 1.0000 | 5.68e-22 | 7ajt:JK, 7d63:RY, 6lqp:RY, 6lqq:RY, 6lqr:RY, 6lqu:RY, 6lqv:RY, 6zqb:JK, 6zqc:JK |
2 | 6rxu:CZ | 44 | 35 | 0.3784 | 0.3182 | 0.4000 | 8.80e-04 | 6rxv:CZ, 6rxz:CZ |
3 | 7mq8:NN | 42 | 20 | 0.2432 | 0.2143 | 0.4500 | 0.65 | 7mq9:NN |
4 | 4xo4:A | 870 | 19 | 0.2162 | 0.0092 | 0.4211 | 1.5 | 3b2p:A, 3b2x:A, 3b34:A, 3b37:A, 3b3b:A, 2dq6:A, 2dqm:A, 6g8b:A, 2hpo:A, 2hpt:A, 3ked:A, 5mfr:A, 5mfs:A, 5mft:A, 3puu:A, 4q4e:A, 4q4i:A, 3qjx:A, 4xmt:A, 4xmu:A, 4xmv:A, 4xmw:A, 4xmx:A, 4xmz:A, 4xn1:A, 4xn2:A, 4xn4:A, 4xn5:A, 4xn7:A, 4xn8:A, 4xn9:A, 4xna:A, 4xnb:A, 4xnd:A, 4xo3:A, 4xo5:A, 5yo1:A, 5yq1:A, 5yq2:A, 5yqb:A, 2zxg:A |
5 | 5ljz:A | 410 | 32 | 0.3243 | 0.0293 | 0.3750 | 1.8 | 5lk1:A |
6 | 5uqd:A | 324 | 16 | 0.1892 | 0.0216 | 0.4375 | 2.6 | |
7 | 5ljx:A | 382 | 23 | 0.2703 | 0.0262 | 0.4348 | 6.3 | 5lk2:A, 5lk3:A |
8 | 6m0a:B | 256 | 12 | 0.2162 | 0.0312 | 0.6667 | 6.8 | 6m0a:A, 6m0a:C, 6m0a:D |
9 | 8xfc:D | 517 | 28 | 0.2162 | 0.0155 | 0.2857 | 7.4 | 8wdb:D |
10 | 1pcx:A | 745 | 19 | 0.2432 | 0.0121 | 0.4737 | 10.0 | 1pd0:A, 1pd1:A |