KGMTPPKTVNFKMKGVADAAFSHEFHLGMYKCNECHTKLFAYKAGAKRFTMADMDKGKSCGACHNGKDAFSSASDCGKCH
P
The query sequence (length=81) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3ov0:A | 318 | 81 | 1.0000 | 0.2547 | 1.0000 | 4.37e-53 | 3oue:A, 3ouq:A, 1rwj:A |
2 | 3ov0:A | 318 | 79 | 0.5679 | 0.1447 | 0.5823 | 2.52e-24 | 3oue:A, 3ouq:A, 1rwj:A |
3 | 3ov0:A | 318 | 76 | 0.4815 | 0.1226 | 0.5132 | 1.02e-17 | 3oue:A, 3ouq:A, 1rwj:A |
4 | 3ov0:A | 318 | 78 | 0.5062 | 0.1289 | 0.5256 | 1.36e-16 | 3oue:A, 3ouq:A, 1rwj:A |
5 | 6m0q:A | 504 | 43 | 0.1728 | 0.0278 | 0.3256 | 0.35 | 4fas:A, 4fas:C, 4fas:B, 1fgj:A, 1fgj:B, 6m0p:A, 6m0p:C, 6m0p:E, 6m0q:C, 6m0q:E, 6m0q:G, 6m0q:I, 6m0q:K, 4n4n:A, 4n4n:C, 4n4n:E, 4n4o:A, 4n4o:C, 4n4o:E |
6 | 6h5l:A | 506 | 43 | 0.1605 | 0.0257 | 0.3023 | 0.37 | |
7 | 2e84:A | 513 | 83 | 0.3333 | 0.0526 | 0.3253 | 0.68 | |
8 | 8qnn:A | 259 | 36 | 0.1728 | 0.0541 | 0.3889 | 0.86 | |
9 | 6yxy:BX | 133 | 46 | 0.2099 | 0.1278 | 0.3696 | 3.0 | 7aoi:BX, 6hiv:BX, 6hix:BX |
10 | 3bxu:A | 71 | 74 | 0.2716 | 0.3099 | 0.2973 | 4.9 | 3bxu:B |