KGIVEKEGYQLDTRRQAQAAYPRIKVLVIHYTADDFDSSLATLTDKQVSSHYLVPAVPPRYNGKPRIWQLVPEQELAWHA
GISAWRGATRLNDTSIGIELENRGWQKSAGVKYFAPFEPAQIQALIPLAKDIIARYHIKPENVVAHADIAPQRKDDPGPL
FPWQQLAQQGIGAWPDAQRVNFYLAGRAPHTPVDTASLLELLARYGYDVKPDMTPREQRRVIMAFQMHFRPTLYNGEADA
ETQAIAEALLEKYGQD
The query sequence (length=256) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3d2y:A | 257 | 256 | 1.0000 | 0.9961 | 1.0000 | 0.0 | 2bh7:A, 3d2z:A, 2wkx:A |
2 | 4bol:A | 243 | 245 | 0.4062 | 0.4280 | 0.4245 | 5.32e-57 | 4bol:B, 4bpa:B |
3 | 4bxd:A | 255 | 237 | 0.4219 | 0.4235 | 0.4557 | 1.18e-56 | 4bxd:B, 4bxe:A, 4bxe:B |
4 | 1j3g:A | 187 | 127 | 0.1953 | 0.2674 | 0.3937 | 5.35e-19 | 2y28:A, 2y28:B, 2y28:C, 2y2b:A, 2y2b:B, 2y2b:C, 2y2d:A, 2y2d:B, 2y2d:C, 2y2e:A, 2y2e:B, 2y2e:C |
5 | 1lba:A | 146 | 67 | 0.0898 | 0.1575 | 0.3433 | 0.56 | |
6 | 4v8m:BZ | 124 | 61 | 0.0703 | 0.1452 | 0.2951 | 1.9 | 8ova:BZ, 8ove:BZ |
7 | 3hmb:B | 156 | 80 | 0.1016 | 0.1667 | 0.3250 | 2.1 | 3hmb:A, 3hmb:C, 3rdr:A |
8 | 6h7f:A | 671 | 49 | 0.0703 | 0.0268 | 0.3673 | 4.0 | 6h7f:B, 6h7f:C, 6h7v:B, 6hcp:A, 6hcp:B, 6hcp:C |
9 | 4krf:A | 817 | 31 | 0.0430 | 0.0135 | 0.3548 | 4.1 | 4kre:A, 4kxt:A, 1si2:A, 1si3:A, 5w6v:A |
10 | 6jfc:B | 161 | 48 | 0.0703 | 0.1118 | 0.3750 | 4.1 | 6jfa:A, 6jfc:A, 6jfd:C, 6jfe:B, 6jff:B, 6jfn:B |
11 | 1jlv:A | 207 | 86 | 0.1094 | 0.1353 | 0.3256 | 7.7 | 1jlv:B, 1jlv:C, 1jlv:D, 1jlv:E, 1jlv:F |
12 | 1t3q:A | 162 | 43 | 0.0586 | 0.0926 | 0.3488 | 8.0 | 1t3q:D |
13 | 1cnz:A | 363 | 59 | 0.0703 | 0.0496 | 0.3051 | 8.5 | 1cnz:B |
14 | 5vm9:C | 785 | 31 | 0.0469 | 0.0153 | 0.3871 | 9.0 | 5vm9:A |