Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
KGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAAREKNRRWDDDVVFKNCAKGVDDQKKD
KRFVNDTLRSEFHKKFMEKYIK

The query sequence (length=102) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 6id0:P 118 103 1.0000 0.8644 0.9903 6.58e-70 8c6j:P, 8ch6:Q, 6ff4:R, 6ff7:R, 8i0s:P, 8i0t:P, 8i0u:P, 8i0v:P, 8i0w:P, 6icz:P, 6id1:P, 5mqf:R, 7qtt:Q, 7w59:P, 7w5a:P, 7w5b:P, 5xjc:P, 5yzg:P, 5z56:P, 5z57:P
2 9fmd:P 106 102 0.8824 0.8491 0.8824 4.60e-58 6qdv:P
3 6zym:R 87 97 0.8529 1.0000 0.8969 1.09e-56
4 8ro0:P 150 133 0.6863 0.4667 0.5263 8.55e-43 8ro1:P
5 8ro2:P 112 112 0.8137 0.7411 0.7411 1.62e-39
6 3jb9:h 90 89 0.4804 0.5444 0.5506 3.22e-27
7 3egw:B 509 74 0.2255 0.0452 0.3108 0.11 3ir5:B, 3ir6:B, 3ir7:B, 1q16:B, 1r27:B, 1r27:D, 1siw:B, 1y4z:B, 1y5i:B, 1y5l:B, 1y5n:B
8 7b9v:P 74 88 0.1765 0.2432 0.2045 0.24 6bk8:H, 7dco:S, 6exn:P, 5gm6:S, 5gmk:S, 6j6g:S, 6j6h:S, 6j6n:S, 6j6q:S, 5lj3:P, 5lj5:P, 5mps:P, 5mq0:P, 5wsg:S, 5y88:P, 5ylz:P
9 3rde:A 552 59 0.1765 0.0326 0.3051 0.35 3rde:B, 3rde:C, 3rde:D
10 8dqx:C 330 54 0.1667 0.0515 0.3148 2.0 8dqw:C, 8dqz:C, 8dr0:C, 8dr1:C, 8dr3:C, 8dr4:C, 8dr5:C, 8dr6:C, 8dr7:C, 8fs3:C, 8fs4:C, 8fs5:C, 8fs6:C, 8fs7:C, 8fs8:C, 7sgz:C, 7sh2:C, 7st9:C, 7stb:C, 7ste:C, 1sxj:C, 7tfh:C, 7tfi:C, 7tfj:C, 7tfk:C, 7tfl:C, 7thj:C, 7thv:C, 8thb:C, 8thc:C, 8thd:C, 7ti8:C, 7tib:C, 7tic:C, 7tid:C, 7tku:C, 8tw7:3, 8tw8:3, 8twa:3, 8twb:3, 7u19:C, 7u1a:C, 7u1p:C
11 5etl:D 160 59 0.1765 0.1125 0.3051 2.9 6an4:A, 6an6:A, 6an6:B, 1dy3:A, 1eqm:A, 5etk:A, 5etl:A, 5etl:B, 5etl:C, 5etm:A, 5etn:A, 5eto:A, 5etp:A, 1ex8:A, 4f7v:A, 1f9h:A, 1g4c:B, 3hd1:A, 3hd2:A, 1hq2:A, 3hsd:A, 3hsd:B, 3hsg:A, 3ht0:A, 3ilj:A, 3ilo:A, 3ip0:A, 7kdo:A, 7kdr:A, 3kuh:A, 4m5g:A, 4m5h:A, 4m5i:A, 4m5j:A, 4m5k:A, 4m5l:A, 4m5m:A, 4m5n:A, 4m5n:B, 1q0n:A, 1rao:A, 1rb0:A, 1rtz:A, 1ru1:A, 1ru1:B, 1ru2:A, 8sif:A, 1tmj:A, 1tmm:A, 1tmm:B, 3ud5:A, 3ude:A, 3udv:A
12 6crm:A 512 63 0.1765 0.0352 0.2857 6.8 4tmu:A
13 6p8u:B 165 69 0.1765 0.1091 0.2609 7.4 6p8s:A, 6p8s:B

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218