KFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYRNKARDIINKHNHKRRHIGKRGRKERENSSQNETLKVTCLSNKE
KRHIMHVKKMNQKELAQTSIDTLKLLYDGSPGYSKVFVDANRFDIGDLVKRAQTSRSRDETCESNPFPRLNNPKKLEPPK
ILSQWSNTIPKTSIFYSV
The query sequence (length=178) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8w2o:B | 178 | 178 | 1.0000 | 1.0000 | 1.0000 | 1.31e-133 | |
2 | 6n7p:B | 195 | 194 | 0.8933 | 0.8154 | 0.8196 | 8.65e-115 | 6g90:C, 6n7r:B, 6n7x:B, 7oqc:C, 7oqe:C, 5zwn:R |
3 | 2vrd:A | 61 | 50 | 0.2191 | 0.6393 | 0.7800 | 2.12e-22 | 4pjo:L, 4pjo:l, 4pjo:M, 4pjo:m, 6qx9:1C, 7vpx:N |
4 | 8q7n:X | 81 | 30 | 0.0787 | 0.1728 | 0.4667 | 0.013 | 8h6k:4I, 8h6l:4I, 8qo9:X, 8qpe:X, 8qzs:X |
5 | 8y6o:V | 101 | 51 | 0.0899 | 0.1584 | 0.3137 | 0.38 | |
6 | 3zj2:A | 71 | 25 | 0.0730 | 0.1831 | 0.5200 | 2.7 | |
7 | 2l7x:A | 77 | 38 | 0.0787 | 0.1818 | 0.3684 | 3.9 | |
8 | 5d2r:A | 420 | 80 | 0.1292 | 0.0548 | 0.2875 | 4.3 | 4q6m:A, 4q6n:A, 4q6o:A, 4q6p:A, 4q6q:A, 4wck:A, 4wcl:A, 4wcm:A, 4wcn:A |
9 | 8hfr:ox | 143 | 32 | 0.0674 | 0.0839 | 0.3750 | 5.5 | 6ft6:I, 3jct:I, 6m62:I, 6n8j:I, 6n8k:I, 6n8l:I, 7ug6:I, 7uoo:I, 7uqb:I, 7uqz:I, 7v08:I, 6ylg:I, 6ylh:I, 6yly:I, 7z34:I |
10 | 7rr5:R | 355 | 70 | 0.1124 | 0.0563 | 0.2857 | 8.5 |