KERVITEFWDGKIIMVSPDDPKYALKKAEEVRELVDSELGFQQVSLRCPSQTRTYMFVSNEKKIVGCLIAEPIREAYRVL
AEPPSLHSWRCSTEPEPAICGISRIWVFALMRRKAIASRMVDAVRSSFMYGSVLTTEEIAFSDPTPDGKLFASTYCKVPD
FLVYNFV
The query sequence (length=167) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5n1u:A | 170 | 167 | 1.0000 | 0.9824 | 1.0000 | 8.85e-124 | 5n1u:B, 5n1w:B, 5n1w:A, 5n22:A, 5n22:C, 5n22:D, 5n22:B |
2 | 6sp0:A | 197 | 166 | 0.6467 | 0.5482 | 0.6506 | 3.61e-78 | |
3 | 5t53:A | 187 | 156 | 0.5988 | 0.5348 | 0.6410 | 5.04e-70 | |
4 | 4mxe:A | 179 | 180 | 0.6228 | 0.5810 | 0.5778 | 5.05e-70 | 4mxe:B |
5 | 5fuv:A | 173 | 62 | 0.1138 | 0.1098 | 0.3065 | 0.92 | 5fuv:B, 5fuw:A, 5fuw:B, 5fux:A, 5fux:B, 5fuy:A, 5fuy:B, 5fuy:C, 5fuy:D, 5fuy:E, 5fuy:F |
6 | 5idy:B | 264 | 56 | 0.1018 | 0.0644 | 0.3036 | 1.5 | 5idy:A, 5vps:A |
7 | 5mpf:B | 202 | 64 | 0.0958 | 0.0792 | 0.2500 | 2.2 | 5mpf:A |
8 | 5bxa:A | 414 | 78 | 0.1377 | 0.0556 | 0.2949 | 6.1 | |
9 | 8jvd:A | 153 | 31 | 0.0719 | 0.0784 | 0.3871 | 9.0 | 8juc:A, 8jve:A, 8jvl:A, 5ngz:A, 5ojj:A, 5ojj:B, 5ojj:C, 5ojj:D, 5ojj:E, 5ojj:F |