BioLiP

>protein
KERIDILFSLAERVFPYSPELAKRYVELALLVQQKAKVKIPRKWKRRYCKKCHAFLVPGINARVRLRQKRMPHIVVKCLE
CGHIMRYPYIK

The query sequence (length=91) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2ki7:B	97	91	1.0000	0.9381	1.0000	2.46e-62	2k3r:A
2	1x0t:A	106	89	0.7802	0.6698	0.7978	5.42e-51	2zae:B, 2zae:D
3	6k0b:G	120	90	0.5495	0.4167	0.5556	3.52e-27	6k0a:G, 6k0a:H, 6k0b:H
4	6agb:K	128	44	0.1758	0.1250	0.3636	0.066	6ah3:K
5	2xkl:A	149	75	0.2308	0.1409	0.2800	0.16
6	6xe6:A	826	31	0.1429	0.0157	0.4194	0.49
7	6fci:A	179	42	0.1429	0.0726	0.3095	0.66	6fch:A, 6fch:B, 6fci:D, 6fci:B, 6fci:C, 6fcl:A, 6fcl:B, 6fd4:B, 6fd4:A, 6fd5:A, 6fd5:B, 6fd6:A, 6fd6:B, 6hgp:A, 6hgq:A, 6hgq:C, 6hgq:D, 6hgq:B, 6hgr:A, 6hgr:B, 6hgs:A, 6hgs:B, 1ore:A, 4x44:A, 4x45:B, 1zn7:A, 1zn7:B, 1zn8:A, 1zn8:B, 1zn9:B
8	7e1q:A	366	44	0.1648	0.0410	0.3409	1.6	7e1r:A, 7e1r:C, 7e1s:C, 7e1s:A
9	2pv0:B	347	48	0.1758	0.0461	0.3333	1.8	2pv0:A, 2pv0:C, 2pvc:B, 2pvc:A, 2pvc:C
10	7r81:H1	194	81	0.2637	0.1237	0.2963	7.0
11	6n8m:V	393	42	0.1429	0.0331	0.3095	8.2	5h4p:w, 8hfr:vV, 6n8k:v, 6n8l:v, 6n8n:V, 6n8o:V, 6qik:w, 6qtz:w, 6rzz:w, 6s05:w, 5t62:V, 5t6r:V, 7z34:v
12	7e2i:D	907	31	0.1319	0.0132	0.3871	8.5	7e2g:D, 7e2h:E

[Back]