KEQITVKHQLDKNGTKVPKNPKKVVVFDFGSLDTLDKLGLDDIVAGLPKQVLPKYLSKFKDDKYADVGSLKEPDFDKVAE
LDPDLIIISARQSESYKEFSKIAPTIYLGVDTAKYMESFKSDAETIGKIFDKEDKVKDELANIDHSIADVKKTAEKLNKN
GLVIMANDGKISAFGPKSRYGLIHDVFGVAPADQNIKASTHGQSVSYEYISKTNPDYLFVIDRGTAIGETSSTKQVVEND
YVKNVNAVKNGHVIYLDSATWYLSGGGLESMTQMIKEVKDGLEKE
The query sequence (length=285) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3gfv:B | 285 | 285 | 1.0000 | 1.0000 | 1.0000 | 0.0 | |
2 | 8bax:A | 281 | 282 | 0.5228 | 0.5302 | 0.5284 | 6.98e-103 | 8b7x:A, 8baw:A, 8baw:B |
3 | 8bf6:A | 278 | 282 | 0.5404 | 0.5540 | 0.5461 | 4.50e-101 | 8bj9:A |
4 | 5ad1:A | 290 | 279 | 0.4211 | 0.4138 | 0.4301 | 2.56e-80 | 5a1j:A, 5a5d:A, 5a5v:A, 5adv:A, 5adv:B, 5adv:C, 5adw:A, 5adw:B, 5adw:C, 2chu:A, 2chu:B, 5lwh:A, 5oah:A, 5oah:B, 5od5:A, 5od5:C, 5tcy:A, 5tcy:B, 5tcy:C |
5 | 6mfl:A | 284 | 292 | 0.3614 | 0.3627 | 0.3527 | 6.09e-56 | 6mfl:B |
6 | 7sf6:A | 294 | 294 | 0.2982 | 0.2891 | 0.2891 | 3.30e-30 | |
7 | 3tny:A | 280 | 275 | 0.2912 | 0.2964 | 0.3018 | 1.39e-20 | |
8 | 4b8y:A | 277 | 269 | 0.2772 | 0.2852 | 0.2937 | 2.79e-19 | 4fil:A, 4fil:B, 4fil:C, 4fil:D |
9 | 3lhs:A | 291 | 296 | 0.3193 | 0.3127 | 0.3074 | 8.47e-18 | 3li2:A, 3li2:B |
10 | 3mwf:A | 292 | 288 | 0.2877 | 0.2808 | 0.2847 | 1.67e-13 | |
11 | 7w8f:A | 278 | 140 | 0.1509 | 0.1547 | 0.3071 | 1.99e-13 | |
12 | 2why:A | 283 | 265 | 0.2421 | 0.2438 | 0.2604 | 2.79e-08 | 2xuz:A, 2xv1:A |
13 | 5ggx:D | 267 | 141 | 0.1228 | 0.1311 | 0.2482 | 3.63e-06 | 5ggx:A, 5ggx:B, 5ggx:C |
14 | 3tlk:A | 296 | 210 | 0.1789 | 0.1723 | 0.2429 | 2.36e-05 | 3tlk:C, 3tlk:B |
15 | 4mlz:A | 299 | 251 | 0.2000 | 0.1906 | 0.2271 | 4.63e-04 | 4mlz:B |
16 | 1efd:N | 262 | 145 | 0.1193 | 0.1298 | 0.2345 | 0.003 | 1esz:A, 1k2v:N, 1k7s:N |
17 | 2q8p:A | 258 | 250 | 0.2070 | 0.2287 | 0.2360 | 0.003 | 2q8q:A |
18 | 5cr9:A | 290 | 151 | 0.1123 | 0.1103 | 0.2119 | 0.006 | |
19 | 7orl:A | 2183 | 61 | 0.0632 | 0.0082 | 0.2951 | 1.5 | 7oa4:AAA, 7oa4:BBB, 7oa4:DDD, 7oa4:GGG, 7ork:A, 7plr:AAA, 7plr:BBB, 7plr:DDD, 7plr:GGG, 2xi5:A, 2xi5:B, 2xi5:C, 2xi5:D, 2xi7:A, 2xi7:B, 2xi7:C, 2xi7:D |
20 | 7oro:A | 2008 | 61 | 0.0632 | 0.0090 | 0.2951 | 1.6 | 7ori:A |
21 | 7orj:A | 2129 | 61 | 0.0632 | 0.0085 | 0.2951 | 1.6 | |
22 | 7orm:A | 2145 | 61 | 0.0632 | 0.0084 | 0.2951 | 1.6 | |
23 | 6z8k:A | 2158 | 61 | 0.0632 | 0.0083 | 0.2951 | 1.6 | 5amq:A, 7orn:A |
24 | 3hvo:A | 559 | 62 | 0.0632 | 0.0322 | 0.2903 | 1.8 | 3hvo:B |
25 | 1cb8:A | 674 | 47 | 0.0491 | 0.0208 | 0.2979 | 1.9 | 1hm2:A, 1hm3:A, 1hmu:A, 1hmw:A |
26 | 5oj1:A | 675 | 35 | 0.0526 | 0.0222 | 0.4286 | 2.2 | 5oiz:A, 2z2m:B, 2z2m:E, 2zc3:B, 2zc3:E, 2zc4:B, 2zc4:E |
27 | 5oj0:A | 658 | 35 | 0.0526 | 0.0228 | 0.4286 | 2.2 | 1qmf:A |
28 | 1pyy:A | 607 | 35 | 0.0526 | 0.0247 | 0.4286 | 2.4 | |
29 | 1reo:A | 484 | 81 | 0.0737 | 0.0434 | 0.2593 | 7.8 | 1tdk:A, 1tdn:A, 1tdo:A |
30 | 6ien:B | 454 | 50 | 0.0561 | 0.0352 | 0.3200 | 7.9 | 6ien:A, 6ien:C, 6ien:D |