BioLiP

>protein
KELIVYFSTQSNNTHRFVQKLDAESIRIPIDEEERIKVDEDYVLIVPTYSGAVPKQVIHFLNDPDNRKHCLGVISSGNTN
FGDSFAIAGPVISYKLKVPLLYQFELIGTKEDVEEVNRIISETFNA

The query sequence (length=126) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7mmq:G	124	125	0.9841	1.0000	0.9920	4.13e-87
2	7mmp:E	139	139	1.0000	0.9065	0.9065	5.72e-87	6ebq:A, 6ebq:B, 7mmp:G, 7mmp:F, 7mmp:H, 7mmq:E, 7mmq:F, 7mmq:H, 7mmr:E, 7mmr:G, 7mmr:F, 7mmr:H, 7mms:E, 7mms:G, 7mms:F, 7mms:H
3	3n3a:C	131	126	0.5238	0.5038	0.5238	5.55e-45	3n39:C, 3n39:D, 3n3a:D, 3n3b:C, 3n3b:D
4	4bmo:B	118	113	0.3413	0.3644	0.3805	1.38e-19	4bmp:B, 2x2o:A, 2x2p:A, 2xod:A, 2xoe:A, 7z3d:B, 7z3e:B
5	1rlj:A	135	125	0.3730	0.3481	0.3760	9.14e-17
6	4n82:B	153	147	0.3492	0.2876	0.2993	5.44e-10	4n82:A
7	8g64:A	169	74	0.1825	0.1361	0.3108	0.023
8	3qnm:A	231	128	0.2540	0.1385	0.2500	0.36
9	8bon:B	1070	56	0.1508	0.0178	0.3393	0.78	8bon:A, 8bon:C, 7nd7:A, 7nd7:B, 7nd7:C, 8xut:B, 8xut:A
10	8xus:B	1063	56	0.1508	0.0179	0.3393	0.80	8if2:B
11	8h3m:C	930	56	0.1508	0.0204	0.3393	0.86
12	4fbg:A	399	27	0.0794	0.0251	0.3704	3.8	4fbg:E, 4fbg:G, 4fbg:H, 4fbg:I, 4fbg:K, 4fbg:M, 4fbg:P
13	8jaf:A	320	30	0.0952	0.0375	0.4000	7.9	8j97:A, 8ja3:B, 8ja3:A
14	1tqy:A	421	41	0.1111	0.0333	0.3415	8.5	1tqy:C, 1tqy:E, 1tqy:G

[Back]