KDSLINLKIQKENPKVVNEINIEDLSLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKK
The query sequence (length=66) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 3fnv:B | 68 | 65 | 0.9848 | 0.9559 | 1.0000 | 3.46e-44 | 3fnv:A, 4oo7:A, 4oo7:B, 4ooa:A, 4ooa:B, 4ooa:C, 4ooa:D, 4ooa:E, 4ooa:F, 7p0p:A, 7p0p:B, 7p0p:C, 7p0p:D |
| 2 | 3ew0:A | 77 | 64 | 0.6667 | 0.5714 | 0.6875 | 2.64e-29 | 6de9:A, 3ew0:B, 4ezf:A, 4ezf:B, 4f1e:A, 4f1e:B, 4f1e:C, 4f1e:D, 4f1e:E, 4f1e:F, 4f1e:G, 4f1e:H, 4f1e:I, 4f1e:J, 4f1e:K, 4f1e:L, 4f1e:M, 4f1e:N, 4f1e:O, 4f1e:P, 4f1e:Q, 4f1e:R, 4f28:A, 4f28:B, 4f2c:A, 4f2c:B, 3lpq:A, 3lpq:B, 7p0o:A, 7p0o:B, 2qd0:A, 2qd0:B, 2qh7:A, 2qh7:B, 2r13:A, 3ree:A |
| 3 | 7yvz:A | 63 | 60 | 0.5303 | 0.5556 | 0.5833 | 1.89e-21 | |
| 4 | 3s2r:B | 78 | 62 | 0.5455 | 0.4615 | 0.5806 | 1.68e-20 | 3s2q:A, 3s2q:B, 3s2r:A |
| 5 | 3tbo:A | 54 | 18 | 0.1515 | 0.1852 | 0.5556 | 0.19 | |
| 6 | 3tbn:A | 87 | 17 | 0.1667 | 0.1264 | 0.6471 | 0.22 | |
| 7 | 3tbn:A | 87 | 19 | 0.1515 | 0.1149 | 0.5263 | 4.3 | |
| 8 | 3tbm:A | 61 | 22 | 0.1667 | 0.1803 | 0.5000 | 0.39 | 3tbm:B |
| 9 | 4ntc:A | 325 | 44 | 0.1970 | 0.0400 | 0.2955 | 1.1 | 4ntc:B |
| 10 | 8iu2:R | 298 | 19 | 0.1515 | 0.0336 | 0.5263 | 1.1 | |
| 11 | 4jn6:C | 339 | 19 | 0.1364 | 0.0265 | 0.4737 | 1.4 | 4jn6:A |
| 12 | 6avj:A | 92 | 30 | 0.1818 | 0.1304 | 0.4000 | 2.6 | 6avj:B, 6avj:C |
| 13 | 4ajw:A | 765 | 33 | 0.1818 | 0.0157 | 0.3636 | 3.3 | 4v0i:A |
| 14 | 5o83:A | 794 | 33 | 0.1818 | 0.0151 | 0.3636 | 3.3 | 4ajw:B, 6dgt:A, 5is5:A, 7r2b:A, 4v0i:B |
| 15 | 2wxl:A | 823 | 33 | 0.1818 | 0.0146 | 0.3636 | 3.3 | 6gy0:A, 5i4u:A, 5i6u:A, 6mul:A, 6mul:B, 6mum:B, 5ngb:A, 7r26:A, 5t27:A, 5t28:A, 5t2b:A, 5t2d:A, 5t2g:A, 5t2i:A, 5t2m:A, 5t7f:A, 5t7f:B, 5t8i:A, 2wxf:A, 2wxh:A, 2wxi:A, 2wxj:A, 2wxm:A, 2wxn:A, 2wxo:A, 2wxp:A, 2wxq:A, 2x38:A, 4xe0:A |
| 16 | 6pyu:A | 930 | 33 | 0.1818 | 0.0129 | 0.3636 | 3.9 | 8bcy:A, 5dxu:A, 6ftn:A, 7jis:A, 5m6u:A, 6mum:A, 5ncy:A, 5ncz:A, 6ocu:A, 7oi4:AAA, 7oij:AAA, 7oil:AAA, 7ois:AAA, 8s3r:A, 5t2l:A, 5t8f:A, 5ubt:A, 2wxg:A, 2wxk:A |
| 17 | 7lq1:A | 950 | 33 | 0.1818 | 0.0126 | 0.3636 | 4.2 | 5ae8:A, 5ae9:A, 6eyz:A, 6ez6:A, 6g6w:A, 6hi1:A, 6hi2:A, 6hi9:A, 5l72:A, 7lm2:A, 6oco:A, 7pop:A, 7por:A, 7pos:A, 7pot:A, 6pyr:A, 6q6y:A, 6q73:A, 6q74:A, 6tnr:A, 6tns:A, 5vlr:A, 6zaa:A, 6zac:A, 6zad:A |
| 18 | 8bn0:A | 342 | 32 | 0.2121 | 0.0409 | 0.4375 | 7.4 | 8bai:A, 8bai:B, 8bai:C, 8bai:D, 8baz:A, 8baz:B, 8bb0:A, 8bb0:B, 8bmy:A, 8bmy:B, 8bmz:A, 8bmz:B |
| 19 | 2jks:A | 284 | 31 | 0.1667 | 0.0387 | 0.3548 | 7.8 | |
| 20 | 6z1p:AV | 129 | 37 | 0.2121 | 0.1085 | 0.3784 | 9.4 |
umich.edu