KDRVTVQEREAEALKQKELEQEAKRMAEERRKYTLKIVEEETKKELEENKRENDEEEYEAWKVRELKRIKRDREDREALE
KEKAEIERMRNLTEEERRAELRANGKVITNKAVKGKYKFLQKYYHRGAFFMDEDEEVYKRDFSAPTLEDHFNKTILPKVM
QVKNFGRSGRTKYTHLVDQDTTSFDSAW
The query sequence (length=188) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8qo9:K | 212 | 180 | 0.9468 | 0.8396 | 0.9889 | 1.84e-124 | 7aav:K, 7abf:K, 7abg:K, 7abi:K, 8h6k:4K, 8q7n:K |
2 | 8swq:B | 278 | 23 | 0.0585 | 0.0396 | 0.4783 | 1.6 | 8swp:B, 8swq:E, 8swr:B, 8sws:B |
3 | 8swq:A | 302 | 23 | 0.0585 | 0.0364 | 0.4783 | 1.8 | 5ifk:A, 5ifk:B, 5ifk:C, 8swp:A, 8swp:D, 8swp:E, 8swq:D, 8swr:A, 8swr:D, 8sws:A, 8sws:D, 8sws:E |
4 | 5u8t:2 | 583 | 52 | 0.0798 | 0.0257 | 0.2885 | 6.2 | |
5 | 7n4y:B | 2455 | 48 | 0.0851 | 0.0065 | 0.3333 | 6.4 | 7n4y:A |
6 | 7d3e:C | 1380 | 42 | 0.0851 | 0.0116 | 0.3810 | 7.3 | 7d3e:A, 7d3f:C, 7d3f:A |