KDRHSKVFTSKGPRDRRVRLSAHTAIQFYDVQDRLGYDRPSKAVDWLIKKAKTA
The query sequence (length=54) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 7vp2:A | 83 | 54 | 1.0000 | 0.6506 | 1.0000 | 1.12e-34 | 7vp1:A, 7vp1:B, 7vp2:B, 7vp4:B, 7vp4:A, 7vp4:F, 7vp4:E, 7vp4:J, 7vp4:I, 7vp5:A, 7vp5:B, 7vp5:E, 7vp5:F, 7vp5:I, 7vp5:J, 7vp7:A, 7vp7:B |
| 2 | 7vp3:C | 62 | 54 | 0.3519 | 0.3065 | 0.3519 | 5.66e-06 | 7vp3:D, 7vp3:J, 7vp3:G, 7vp3:L, 7vp3:I, 7vp3:N, 7vp3:P |
| 3 | 6xpn:B | 259 | 33 | 0.1852 | 0.0386 | 0.3030 | 0.87 | 6xpn:A |
| 4 | 3no5:E | 275 | 17 | 0.1667 | 0.0327 | 0.5294 | 2.8 | 3no5:A, 3no5:B, 3no5:C, 3no5:D, 3no5:F |
| 5 | 6tz8:B | 174 | 30 | 0.2593 | 0.0805 | 0.4667 | 3.0 | 6tz8:E |
| 6 | 2wl9:A | 300 | 36 | 0.2407 | 0.0433 | 0.3611 | 5.2 | 2wl3:A, 2wl3:B, 2wl3:C, 2wl3:D, 2wl9:B, 2wl9:C, 2wl9:D |
| 7 | 5hkc:A | 114 | 28 | 0.1852 | 0.0877 | 0.3571 | 5.7 | 5hk0:B, 5hk0:D, 5hk3:B |
| 8 | 7wrr:A | 650 | 38 | 0.2407 | 0.0200 | 0.3421 | 6.5 | 7wrr:B, 7wrr:C, 7wrr:D, 7wrt:A, 7wrt:B, 7wrt:C, 7wrt:D |
| 9 | 7ane:aa | 1514 | 21 | 0.1852 | 0.0066 | 0.4762 | 8.3 | |
| 10 | 9biw:B | 528 | 40 | 0.2037 | 0.0208 | 0.2750 | 9.0 | 9biw:A |
| 11 | 4ylz:C | 140 | 37 | 0.2037 | 0.0786 | 0.2973 | 9.8 | 5cbl:A, 5cbl:B, 5cbl:C, 5cbl:D, 6wab:A, 6wab:B, 4ylz:A, 4ylz:B, 4ylz:D, 4ym0:D, 4ym0:A, 4ym0:B, 4ym0:C, 4ym1:A, 4ym1:B, 4ym1:C, 4ym2:A, 4ym2:B, 4ym2:C, 4ym2:D, 4ym3:A, 4ym3:B, 4ym3:C, 4ym3:D |
umich.edu