KDQAEKYQERSLRQKYNLLHVLPTLNSRALSGLYYKNFHNSVKRYQIMLPEQLKSGKFCSHCGCVYVPNFNASLQLTTN
The query sequence (length=79) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6w6v:K | 79 | 79 | 1.0000 | 1.0000 | 1.0000 | 2.95e-55 | |
2 | 7c79:K | 104 | 73 | 0.8734 | 0.6635 | 0.9452 | 1.31e-47 | 7c7a:K |
3 | 2x41:A | 715 | 51 | 0.1899 | 0.0210 | 0.2941 | 1.2 | 2x42:A |
4 | 5hmq:D | 624 | 36 | 0.1392 | 0.0176 | 0.3056 | 2.7 | 5hmq:A, 5hmq:B, 5hmq:C, 5hmq:E, 5hmq:F |
5 | 8bpx:AD | 196 | 20 | 0.1139 | 0.0459 | 0.4500 | 3.1 | 8bel:D, 8bel:N, 8bpx:BD, 8bq5:AD, 8bq5:BD, 8bq6:AD, 8bq6:BD |
6 | 3c0t:A | 201 | 28 | 0.1392 | 0.0547 | 0.3929 | 4.6 | |
7 | 5msy:A | 457 | 34 | 0.1646 | 0.0284 | 0.3824 | 5.0 | 5msy:B, 5msy:C |
8 | 5fcz:A | 499 | 20 | 0.1139 | 0.0180 | 0.4500 | 6.3 | 4c7f:A, 4c7f:B, 4c7g:A, 1hp5:A, 1jak:A, 1m01:A, 1m03:A, 1m04:A |
9 | 4qbg:B | 217 | 34 | 0.1519 | 0.0553 | 0.3529 | 8.9 | 4typ:B, 4typ:A |
10 | 8xr6:V | 137 | 23 | 0.1519 | 0.0876 | 0.5217 | 9.4 | 8wb4:V, 8wb4:v, 8xr6:v |