BioLiP

>protein
KDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRVEVKKFVKIGRPGYKVTKQRDSELFQIDYPEIAEGI
MPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQ

The query sequence (length=144) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8i0r:v	173	153	0.9028	0.7514	0.8497	1.32e-90	7abg:F, 7abh:F, 6ff4:7, 6ff7:7, 8i0p:v, 8i0t:v, 7q4o:1, 7q4p:1, 8qo9:G, 6qx9:A2, 8qxd:8, 8r0a:8, 8r0b:8, 8rm5:8, 7vpx:B
2	8ch6:I	185	145	0.8611	0.6703	0.8552	9.47e-83	7abi:F, 7onb:M, 7qtt:I, 5z56:v, 5z57:v
3	7dco:v	207	160	0.3333	0.2319	0.3000	5.59e-13	5gm6:I, 5zwm:v, 5zwo:v
4	5nrl:U	196	180	0.3472	0.2551	0.2778	4.21e-11
5	6g90:U	196	180	0.3333	0.2449	0.2667	2.87e-10	7oqb:U, 7oqe:U
6	8qzs:r	114	42	0.0972	0.1228	0.3333	0.004	7abf:N, 7abg:N, 7abi:N, 8h6k:4N, 5o9z:N, 8q7n:r, 8qpe:r
7	6edw:C	724	31	0.0972	0.0193	0.4516	1.9	6ee1:A, 6ee1:C
8	6edw:B	746	31	0.0972	0.0188	0.4516	2.0	6edw:A, 6edw:D, 6edz:A, 6edz:B, 6edz:D, 6ee1:B, 6ee1:D
9	6edz:C	723	31	0.0972	0.0194	0.4516	2.0
10	8idf:A	459	28	0.0764	0.0240	0.3929	5.0
11	1zu1:A	127	36	0.0764	0.0866	0.3056	5.1
12	5nmx:D	409	116	0.1944	0.0685	0.2414	6.4	5nmw:A, 5nmw:B, 5nmw:C, 5nmw:D, 5nmx:A, 5nmx:B, 5nmx:C
13	1xed:A	111	39	0.0833	0.1081	0.3077	6.8	1xed:B
14	8q7n:X	81	32	0.0764	0.1358	0.3438	7.8	8h6k:4I, 8h6l:4I, 8qo9:X, 8qpe:X, 8qzs:X
15	6iw6:A	438	35	0.0903	0.0297	0.3714	9.9	6iw6:B

[Back]