BioLiP

>protein
KDGYKPDVKIEYVDETGRKLTPKEAFRQLSHRFHGKGSGKMKTERRMKKLDEEALLKKM

The query sequence (length=59) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8r0a:S	86	59	1.0000	0.6860	1.0000	3.60e-38
2	6qw6:S	126	59	1.0000	0.4683	1.0000	7.71e-38	8h6e:4S, 8h6j:4S, 8qp8:S, 8qp9:S, 8qpk:S, 6qx9:S, 8qxd:S, 8r08:S
3	7mqa:LO	819	37	0.2542	0.0183	0.4054	1.4
4	7mq8:LO	848	37	0.2542	0.0177	0.4054	1.4	7mq9:LO
5	2vyt:A	214	18	0.1695	0.0467	0.5556	3.4	4edu:A
6	5wm3:A	537	19	0.1695	0.0186	0.5263	4.0	5wm2:A, 5wm4:A, 5wm5:A, 5wm6:A, 5wm7:A
7	2vyt:B	183	18	0.1695	0.0546	0.5556	4.0
8	3m6a:A	496	28	0.2203	0.0262	0.4643	4.4	3m6a:B, 3m6a:C, 3m6a:D, 3m6a:E, 3m6a:F
9	6m0q:A	504	27	0.2034	0.0238	0.4444	6.3	4fas:A, 4fas:C, 4fas:B, 1fgj:A, 1fgj:B, 6m0p:A, 6m0p:C, 6m0p:E, 6m0q:C, 6m0q:E, 6m0q:G, 6m0q:I, 6m0q:K, 4n4n:A, 4n4n:C, 4n4n:E, 4n4o:A, 4n4o:C, 4n4o:E
10	5ahj:Z	222	33	0.1864	0.0495	0.3333	7.2	3bdm:L, 3bdm:Z, 5bou:Z, 5bxl:Z, 5cgf:Z, 5cgg:Z, 5cgh:Z, 5cgi:Z, 5cz4:Z, 5cz5:L, 5cz5:Z, 5cz6:Z, 5cz7:Z, 5cz8:Z, 5cz9:L, 5cz9:Z, 5cza:Z, 5d0s:L, 5d0s:Z, 5d0t:Z, 5d0v:Z, 5d0w:Z, 5d0x:Z, 5d0z:L, 5d0z:Z, 3d29:L, 3d29:Z, 5dki:Z, 5dkj:Z, 5fg7:Z, 5fg9:Z, 5fga:Z, 5fgd:Z, 5fge:Z, 5fgf:Z, 5fgg:L, 5fgg:Z, 5fgh:Z, 5fgi:L, 5fgi:Z, 5fhs:L, 5fhs:Z, 1fnt:a, 9fst:Z, 9fsv:Z, 9ft1:L, 9ft1:Z, 4fzc:L, 4fzc:Z, 4fzg:L, 4fzg:Z, 1g0u:L, 1g0u:Z, 4g4s:M, 1g65:L, 1g65:Z, 6g7f:Z, 6g8m:Z, 6g8n:Z, 4gk7:L, 4gk7:Z, 6gop:Z, 6h39:L, 6h39:Z, 4hrc:L, 6htc:Z, 6htr:L, 6htr:Z, 6hub:Z, 6huq:L, 6huu:L, 6huu:Z, 6huv:Z, 6hv3:Z, 6hv4:Z, 6hv7:Z, 6hva:L, 6hva:Z, 6hvr:Z, 6hvs:L, 6hvs:Z, 6hvt:L, 6hvt:Z, 6hvu:L, 6hvu:Z, 6hvv:Z, 6hvx:Z, 6hvy:Z, 6hw0:Z, 6hw3:L, 6hw3:Z, 6hw4:Z, 6hw5:Z, 6hw6:L, 6hw6:Z, 6hw7:L, 6hw7:Z, 6hw8:Z, 6hw9:Z, 6hwa:Z, 6hwb:L, 6hwb:Z, 6hwc:Z, 6hwd:Z, 6hwe:L, 6hwe:Z, 6hwf:Z, 4inr:Z, 4int:Z, 4inu:L, 4inu:Z, 1jd2:L, 5jhr:L, 5jhr:Z, 5jhs:Z, 4jsq:L, 4jsq:Z, 4jsu:L, 4jsu:Z, 4jt0:L, 4jt0:Z, 5l52:L, 5l52:Z, 5l54:Z, 5l55:L, 5l55:Z, 5l5a:Z, 5l5b:Z, 5l5d:Z, 5l5e:Z, 5l5f:Z, 5l5h:Z, 5l5i:L, 5l5i:Z, 5l5j:Z, 5l5o:L, 5l5o:Z, 5l5p:Z, 5l5q:Z, 5l5r:Z, 5l5s:Z, 5l5t:L, 5l5t:Z, 5l5u:L, 5l5u:Z, 5l5v:L, 5l5v:Z, 5l5w:Z, 5l5x:Z, 5l5y:L, 5l5y:Z, 5l5z:Z, 5l60:L, 5l60:Z, 5l61:Z, 5l62:Z, 5l63:L, 5l63:Z, 5l64:L, 5l64:Z, 5l66:Z, 5l67:L, 5l67:Z, 5l68:Z, 5l69:L, 5l69:Z, 5l6a:Z, 5l6b:Z, 5l6c:L, 5l6c:Z, 5lai:Z, 5laj:Z, 5ltt:Z, 5m2b:L, 5m2b:Z, 3mg4:L, 3mg4:Z, 3mg6:L, 3mg6:Z, 3mg7:L, 3mg7:Z, 3mg8:L, 3mg8:Z, 4nnn:Z, 4nnw:Z, 4no1:Z, 4no6:L, 4no6:Z, 4no8:Z, 4no9:Z, 3nzj:L, 3nzj:Z, 3nzw:L, 3nzw:Z, 3nzx:L, 3nzx:Z, 7o2l:Z, 3oeu:L, 3oeu:Z, 3oev:L, 3oev:Z, 8ohz:L, 8ohz:Z, 8oi1:L, 8oi1:Z, 3okj:L, 3okj:Z, 8olr:Z, 4qby:Z, 4qlq:Z, 4qls:L, 4qls:Z, 4qlt:L, 4qlt:Z, 4qlu:L, 4qlv:L, 4qlv:Z, 4qux:Z, 4quy:Z, 4qv1:Z, 4qv3:Z, 4qv6:Z, 4qv7:Z, 4qv8:Z, 4qv9:Z, 4qvl:Z, 4qvm:Z, 4qvn:Z, 4qvp:Z, 4qvq:Z, 4qvw:Z, 4qvy:Z, 4qw1:Z, 4qw3:Z, 4qw4:L, 4qw4:Z, 4qw5:L, 4qw5:Z, 4qw6:L, 4qw6:Z, 4qw7:L, 4qw7:Z, 4qwf:L, 4qwf:Z, 4qwg:L, 4qwg:Z, 4qwi:L, 4qwi:Z, 4qwj:L, 4qwj:Z, 4qwk:L, 4qwk:Z, 4qwl:L, 4qwl:Z, 4qwr:L, 4qwr:Z, 4qws:L, 4qws:Z, 4qwu:Z, 4qwx:Z, 4qz0:Z, 4qz2:Z, 4qz3:Z, 4qz4:Z, 4qz5:Z, 4qz6:Z, 4qz7:Z, 4qzw:Z, 4qzx:Z, 4qzz:Z, 4r02:L, 4r02:Z, 4r17:Z, 4r18:Z, 8rhj:L, 8rhj:Z, 8rhk:L, 8rhk:Z, 8rhl:L, 8rhl:Z, 4rur:L, 4rur:Z, 1ryp:M, 1ryp:1, 3sdi:L, 3sdi:Z, 3sdk:L, 3sdk:Z, 3shj:L, 3shj:Z, 3un4:L, 3un4:Z, 4y69:Z, 4y6a:Z, 4y6v:Z, 4y6z:Z, 4y70:Z, 4y74:Z, 4y75:Z, 4y77:Z, 4y7x:Z, 4y7y:Z, 4y80:Z, 4y81:Z, 4y82:Z, 4y84:Z, 4y8g:Z, 4y8h:Z, 4y8i:Z, 4y8j:Z, 4y8k:Z, 4y8l:Z, 4y8m:Z, 4y8n:Z, 4y8o:Z, 4y8p:Z, 4y8q:Z, 4y8r:Z, 4y8t:Z, 4y8u:Z, 4y9y:Z, 4ya0:Z, 4ya1:Z, 4ya3:Z, 4ya4:Z, 4ya5:Z, 4z1l:Z, 6zou:L, 6zou:Z, 6zp6:L, 6zp6:Z, 6zp8:L, 6zp8:Z

[Back]